SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042317 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042317
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 458-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.49e-25
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 682-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 570-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 723-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 318-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 10 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 420-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000001
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 12 Region: 223-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000032
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042317   Gene: ENSCAFG00000029028   Transcript: ENSCAFT00000049783
Sequence length 805
Comment pep:novel chromosome:CanFam3.1:1:111130819:111142419:-1 gene:ENSCAFG00000029028 transcript:ENSCAFT00000049783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMFKEAVTFNDVAVAFTEEELGLLDSAQRKLYQDVMLENFRNLVSVGHQPFKRDKWQIE
REEKLWLMKTTTQIERNVGGNNQDELRNFQDKGPHEELSCWQIWQHIANDLTRCQNSMIN
SSEFHKQGDSPCQLGAELSIQISEEENCGLNCKVDGPNRTENSDFAILRVQDSWRKTLTE
SQSYRNRYQQISMKNKLCRCKQNIDVVSWISHHLDHGIHRSDKSYSHDDCQKGSMKVSAL
DQESMIHMRQKPYQCNECEKTFSDLSTFDLHQQLHSKAKSHMCSECGKGFRYSSVLRIHQ
RVHMGEKGHKCGECGEEFSQSSLLQTHQKVHTVEKPFKCEECGKGFVRRSALTVHCKVHT
GEKPYNCEECGRAFSQASHLQDHQRVHTGEKPFRCDACGKSFSRNSHLQSHQRVHTGEKP
YKCEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKSYICN
VCGKGFTLSSNLQAHQRVHTGEKPYKCDECGKSFRRNSHYQVHLVVHTGEKPYKCEVCGK
GFSQSSYLQIHLKAHSIEKPYKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSR
RADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSSHL
QAHQKVHTGEKPYKCEECGKGFKWSLNLDMHQRVHTGEKPYKCGECGKHFSQASSLQLHQ
SVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCETCGKSFSWRSNLTIHHRIHA
GDKSYKSNRSGKNIIESTQENSSIK
Download sequence
Identical sequences J9P984
ENSCAFP00000042317 ENSCAFP00000042317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]