SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000043016 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000043016
Domain Number 1 Region: 2674-2962
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-126
Family BEACH domain 0.0000000151
Further Details:      
 
Domain Number 2 Region: 3033-3232,3395-3427
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.11e-32
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 2520-2642
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3435-3503
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1088-1286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000686
Family Trypanosoma sialidase, C-terminal domain 0.085
Further Details:      
 
Domain Number 6 Region: 470-514,580-658,852-911
Classification Level Classification E-value
Superfamily ARM repeat 0.00000266
Family Armadillo repeat 0.072
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000043016
Domain Number - Region: 1410-1461,1513-1579,1614-1704
Classification Level Classification E-value
Superfamily ARM repeat 0.000189
Family HspBP1 domain 0.069
Further Details:      
 
Domain Number - Region: 2330-2406
Classification Level Classification E-value
Superfamily Cyclin-like 0.000816
Family Retinoblastoma tumor suppressor domains 0.01
Further Details:      
 
Domain Number - Region: 117-410
Classification Level Classification E-value
Superfamily ARM repeat 0.0317
Family Armadillo repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000043016   Gene: ENSCAFG00000009247   Transcript: ENSCAFT00000045131
Sequence length 3512
Comment pep:known_by_projection chromosome:CanFam3.1:32:8429886:8662967:-1 gene:ENSCAFG00000009247 transcript:ENSCAFT00000045131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPLA
ERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVNELKPAGITTGAP
FLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTNFLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKISKLPEVQSKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSI
IAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSIE
DQKHLALLVMETLTVLLQGSNTNAGIFREFGGARCAHNIVKYPQCRQHALMIIQQLVLSP
NGEDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVA
MERSLSSPPKNGWEKVNQNHVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISPMNVFPSNTQPFQRLLEEDVISMDTVSPTLRHCSKLFIYLYKVATDSF
DSRAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPVYPPKNIVDLKLHVATTSLQ
SSDAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVANILQSLVHTERNQQVMCEAGL
HARLLQRCSAALADEDHSLHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLL
KQYRVHKPSSLSYEPEMRSSLITSMEGLGSDNVFSLHEDNHYRISKSLVKSAEGSTVPLT
RVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLTD
GAVVSGIGSGERFFPPPSGLSYSSWFCIEHFSSPPNNHPVRLLTVVRRANSSEQHYVCLA
IILSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIVEGQWHHLVLVM
SKGMLKNSTAALYIDGQLVNTVKLHYVHSTPGGSGSANPPVVSTVYAYVGTPPAQRQIAS
LVWRLGPTHFLEEVLPPSNVTTIYELGPNYVGSFQAVCMPCKDAKCEGVVPSPVSLVPEE
KVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLIHNSAGHLNGPA
RTVGATLIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKS
NPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQD
LLCDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQ
PTIAAISNVLSFLLQGFPNSNDLLRFGQFISSTLPTFAVCEKFVVMEINNEEKLDTGTEE
EFGGLVSANLILLRNRLLDILLKLVYTSKEKTSINLQACEELVKTLGFDWIMMFMEEHLH
STTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGR
STVREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQFDLDSIW
TFIFGVPASSGTVVSSIHNVCTEAAFLLLGMLRSMLNSPWQSEEEGSWLREYPVTLMQFF
RYLYHNVPDLASMWMSPDFLCALAATVFPFNIRPYSEMVTDLDDEVGSPAEEFKAFAADT
GMNRSQSEYCNVGTKTYLTNHPAKKFVFDFMRVLIIDNLCLTPASKQTPLIDLLLEASPE
RSTRTQQKEFQTYILDSVMDHLLAADVLLGEDASLPITSGGSYQVLVNNVFYFTQRVVDK
LWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTILYQFSRAHKTVPQQVA
LLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDGFGLEAEARMTTWHIMI
PSDIEPDGGYSQDISEGRQLLIKAVNRVWTELIHSKKQALEELFKVTLPVNERGHVDIAI
ARPLIEEAGLKCWQNHLAHEKKCISRGEALVPTTQSKLSRVSSGFGLSKLTGSRRNRKES
GLNKHSLSTQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYVTEEWCQIEYELLRER
GLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPETEQETNVASEVPSKQP
ETPDDIIPQKKPARYRRAISYDSKEYYMRLASGNPAIVQDAIVESSEGEAAQQEPEHGED
TIAKVKGLVKPPLKRSRSAPDGGDEESQEQLQDQIAEGSSIEEEEKTDNATLLRLLEEGE
KIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIETLPPNMHEPIIPRG
ARQGPSQLKRTCSIFAYEDIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGIRNKVYQR
FLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNT
LAGRSYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQTDERLAQYKKRYKDW
EDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYS
ASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVH
REALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETAT
IGFINNFGQIPKQLFKKPHPPKRVRSRLNGDSMGASAPPGSSSDKIFFHHLDNLRPSLTP
VKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLSCRLGTYESDKVVTIYE
CLSEWGQILCAICPNPKLVITGGTSTVVCVWEMGTSKEKAKTLTLKQALLGHTDTVTCAT
ASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINELTGDIVSCAGTYIHV
WSINGNPIVSVNTFTGRSQQIVCCCVSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPET
PAPEPVEVLEMQEDCPEAQIGQEAQDEDSSDSEADEQSTSQDPKDVPSQPSSTSHRPRAA
SCRAAAVWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLNHPHPSPIEV
RNYSRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEITALGVSKDHSRILVGDSRGRV
FSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSEI
KRLKISSPVRVCQNCYYNLQHERGSEDGPRNC
Download sequence
Identical sequences J9PB38
ENSCAFP00000013654 ENSCAFP00000043016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]