SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|DEHA2G10802g from Debaromyces hansenii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|DEHA2G10802g
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-30
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 246-332
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 9.16e-20
Family HSP40/DnaJ peptide-binding domain 0.0000569
Further Details:      
 
Domain Number 3 Region: 167-244
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000000131
Family HSP40/DnaJ peptide-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|DEHA2G10802g
Sequence length 337
Comment similar to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1 HSP40 family chaperone [Debaryomyces hansenii] Complete CDS. DEHA2G10802g
Sequence
MVKETKLYDLLGVQPSASEQELKKAYRKLALKYHPDKPTGDTEKFKEISEAFDILSNGDK
RQVYDDYGLEAARGNAPAGGNPFAGAGHAGGGGGASPFGGFSSSGGFSQADAFNIFSQMG
GFGMGGGGGGSDDFGFGGFGGGSGFGGMPGGFSQGHSSRSRPEPDTVTISLPVSLEDLYH
GGVKKMKLNRKGISGNKESKVMTINIKPGWKVGTKINFANEGDYQRECHARQTVQFILEE
KPHPIFKREGNNLKMNLPLTFKESLCGFSKEVNTIDGRRIPLLRSSPIQPNTSTTYPGLG
MPISKLPGSRGDLEIVFKVDYPVSLNAEQKQVINQYF
Download sequence
Identical sequences gnl|GLV|DEHA2G10802g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]