SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|DEHA2C06820g from Debaromyces hansenii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|DEHA2C06820g
Domain Number 1 Region: 34-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000125
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 83-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000487
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 3 Region: 148-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000209
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 4 Region: 196-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000607
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Weak hits

Sequence:  gnl|GLV|DEHA2C06820g
Domain Number - Region: 347-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00045
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|DEHA2C06820g
Sequence length 452
Comment similar to uniprot|P39933 Saccharomyces cerevisiae YPR186c PZF1 Transcription factor IIIA (TFIIIA) with putative Zn-fingers [Debaryomyces hansenii] Complete CDS. DEHA2C06820g
Sequence
MESSETASVSSRASSSSARPKNYICDEPDCGKAYSKPSLLEQHKRSHTNERPFKCSETGC
DKSFLRKSHLQAHLLSHEDQESKPFQCATCGKGVNTLQHLKRHEITHTKSFICTFEGCNE
SFYKHQSLRHHTLSVHEKKLLCNKCNKSFNRPYRLAQHNIKYHSDSPAYQCDHQGCFGNF
MTWSALQLHIKTEHPKIKCPICGKGCVGKKGLRSHMNIHDEEKIVKLWNCNYCNIGKFVK
KADLIDHYNTYHDRNLPDDLLKPIEREQLDKLLSEKDSTNIDFNTLEGLQSKGFVEVPSD
EEKEENDYMSNGLQASHKSLNSLNLTLESGKASIVDLILNNYLKRKVPCPKKNCDRMFSR
DYDLERHLKWHESHLKKIEAFLKSLELEEKVPDSNMHDKRLFPENDEPVMATKRHHAMES
SDDDFELDDLIDEELKSIQAGQTASNNTTNVK
Download sequence
Identical sequences gnl|GLV|DEHA2C06820g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]