SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000937 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000937
Domain Number 1 Region: 199-344
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-38
Family Second domain of FERM 0.000000706
Further Details:      
 
Domain Number 3 Region: 498-586
Classification Level Classification E-value
Superfamily Moesin tail domain 1.96e-32
Family Moesin tail domain 0.0000241
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-26
Family First domain of FERM 0.000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000937   Gene: ENSCAFG00000000661   Transcript: ENSCAFT00000001022
Sequence length 586
Comment pep:novel chromosome:CanFam3.1:1:48161362:48210131:-1 gene:ENSCAFG00000000661 transcript:ENSCAFT00000001022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKETHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAADQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQDNLQEEGTEYTGYSAELSSEGIMDDRNEEKRITEAEKNERVQRQLMTLTSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences E2RSI6
NP_001273918.1.84170 ENSCAFP00000000937 ENSCAFP00000000937 9615.ENSCAFP00000000937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]