SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001233 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001233
Domain Number 1 Region: 100-208
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-30
Family Second domain of FERM 0.0028
Further Details:      
 
Domain Number 2 Region: 6-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-17
Family First domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001233   Gene: ENSCAFG00000000864   Transcript: ENSCAFT00000001346
Sequence length 243
Comment pep:novel chromosome:CanFam3.1:1:55600413:55610133:-1 gene:ENSCAFG00000000864 transcript:ENSCAFT00000001346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEARDVLVLLPTREQLRLVVGVQATGRELFQQVCDVTSIKEAHFFGLSVVRNDEYMFM
DLEQKLSKYFSKDWKRDAHEAGGRPRAPFVTFLRVRYYVDNGRVISDRTARHLYYCHLKE
RVLRSQCAHREEAYFLLAAYGLQADLGNHREPVHVGRYFEPQAYFPPWIIAKRGRAYILR
HAPAMHREQRGLNPKEAVLCFIREACRLEDVPVHFFRLYKVRPCGTRDFRPPHICSAQGA
QMS
Download sequence
Identical sequences F6UVN3
ENSCAFP00000001233 ENSCAFP00000001233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]