SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001290 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001290
Domain Number 1 Region: 802-910
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 285-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 6-138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 247-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000105
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 661-799
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000677
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 178-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000285
Family EGF-type module 0.032
Further Details:      
 
Domain Number 7 Region: 137-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000289
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000001290
Domain Number - Region: 618-669
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000889
Family Growth factor receptor domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001290   Gene: ENSCAFG00000000907   Transcript: ENSCAFT00000001404
Sequence length 988
Comment pep:novel chromosome:CanFam3.1:10:22222556:22353464:1 gene:ENSCAFG00000000907 transcript:ENSCAFT00000001404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGRQCEDIDECENDYYNGGCV
HECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYECQCHSGFF
LSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNY
GNGGCQHSCEDTDTGPMCGCHQKYALHSDGRTCIEKDEAAIERSQFNATSVADVDKRVKR
RLLMETCAVNNGGCDRTCRDTATGVRCSCPVGFTLQPDGKTCKDINECLTNNGGCDHFCR
NKVGSFECGCRKGKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHRGYTLYGTTH
CGDVDECSMNNGSCDQGCINTRGSYECVCPPGRRLHWNQKDCVEMGKCLSRAKASPWAQL
SCSKVGGVESCSLSCPAHSLFVPDSENSYSLSCGVPGLQGKMLQKRNSTSSSTGPSCSGV
PAPIRQKARFKIRDAKCHLRPHSREPAKEALRQLLLENCHLTFVTLKCDSSKKRRRGRKS
PSKEVTHITAEFEVEIKMEEASDTCEADCMRKRAEQSLQAAIKTLRKSIGRQHFSIQVAG
TEYAMAQWPAKALEGQGACGTGQVLQDGKCVACGPGTHFSGEPGQCVPCVPGTYQDRDGQ
LSCTPCPSSDGLGLTGARNVSECGGQCSPGFFSQDGFRPCQACPVGTYQPEPGRTGCFSC
GGGLLTKHEGTVSFQDCETKVHCSPGHHYNTTTHRCIRCPIGTYQPEFGQNHCITCPGNT
STDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWHISPPPKRRILIVV
PEIFLPVEDECGDVLVMRKSASPASITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSG
KGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYT
AQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences F1PQD9
ENSCAFP00000001290 9615.ENSCAFP00000001290 ENSCAFP00000001290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]