SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001563 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001563
Domain Number 1 Region: 2756-2920
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-36
Family Laminin G-like module 0.0000000842
Further Details:      
 
Domain Number 2 Region: 2926-3106
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.08e-35
Family Laminin G-like module 0.0000000255
Further Details:      
 
Domain Number 3 Region: 2324-2511
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-31
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 2511-2699
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.38e-28
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 5 Region: 2139-2315
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-23
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 801-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 7 Region: 851-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000239
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 8 Region: 1406-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 378-506,691-703
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000129
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 743-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 11 Region: 1463-1515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 12 Region: 904-950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 13 Region: 255-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 14 Region: 1046-1094
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 15 Region: 953-1002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 16 Region: 1513-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 17 Region: 312-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 18 Region: 1000-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 19 Region: 57-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000034
Family APC10-like 0.055
Further Details:      
 
Domain Number 20 Region: 1824-2101
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000732
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000001563
Domain Number - Region: 1110-1149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000725
Family Laminin-type module 0.022
Further Details:      
 
Domain Number - Region: 1364-1393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family Laminin-type module 0.063
Further Details:      
 
Domain Number - Region: 1694-1869
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00772
Family Apolipoprotein A-I 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001563   Gene: ENSCAFG00000001106   Transcript: ENSCAFT00000001697
Sequence length 3109
Comment pep:known chromosome:CanFam3.1:1:67514264:68100315:1 gene:ENSCAFG00000001106 transcript:ENSCAFT00000001697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQAQGLFPAVLNLASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQCRICNQNSSN
PYQRHPITNAIDGKNTWWQSPSIKNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNW
ILERSLDGVDYRPWQYHAVTDTECLALYNIYPRTGPPSYAKDDEVICTSFYSKIHPLENG
EIHISLINGRPSADDPSPELLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTR
RYYYSVKDISVGGMCICYGHARACPLDPVTNKSRCECEHNTCGDSCDQCCPGFHQKPWRA
GTFLTKTECEACNCHGKAEECYYDENVARRNLSLNIHGKYIGGGVCINCTQNTAGINCET
CIDGFFRPKGVSPSYPRPCQPCHCDPVGSLNEVCVKDEKRARRGLAPGSCHCKPGFRGVS
CDRCARGYTGYPDCKPCNCSGAGSTNEDPCFGPCNCKENVEGGDCGRCKAGFFNLQEDNH
KGCDECFCSGVSDRCQSSYWTYGQIQDMRGWYLTDISGRIRVAPQQDDVDPPQQISVSSL
EAHRALAQGYYWSAPAPYLGNKLAAAGGQLTFTISYDFEAEGEDAESVLQVTVILEGNDL
RISTAQDEVYLQPYEEHIHVLSLKEELFTTHGTNFPVSRREFMTVLASLKRVLIQITYGP
GVEAIFRLGSVGLESAVPYPTDRSIAAAVEVCQCPPGYSGSSCEKRQQANASSNLIPASN
TKSCWPRHRRVNGTVFGGICEPCQCFGHAESCDDLTGECLNCKDHTGGPHCNQCLPGFYG
DPSKGTSEDCLPCACPLSIPSNNFSPTCHLERGLGLMCDACPAGYTGPRCDRCAEGYFGQ
PSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCRICKPGTAGRRCELCADGYFGDAVEAKN
CQPCGCHVNSSLSESCHARTGQCECKPNVQGRRCDECKPETFGLQSGRGCVPCKCNSFGS
KSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACDCSHLGNNCDPKTGQCICPP
NTVGEKCSKCSPNTWGHSIITGCKACNCSTVGSLDFQCNINTGQCSCHPKFSGAKCTECN
QGHWNYPHCSPCECFLPGTDDRTCDPETKKCSCVDQTGQCTCKVNVEGVHCDRCRPGNFG
LDAKNPLGCSQCYCFGATTQCSEAKGLIRTWVTLKPEQTILPLVDEALQHTTTKGIVFQH
PEIVAHMDLVRQDLRLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYNPQV
IIRGGTPTHTRIIIRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTVTREDFLDVLY
DIHYILIKATYGNIMRQSRISEVSLAVGQPGRGTAAAPPARLIERCECPAGHSGLSCEAC
GPGFYRLPSEPGSAAARPALGPCVPCQCHGHSSLCDPETSKCQNCQHHTAGDFCERCALG
YYGIVRGLPNDCQQCACPLISSSNNFSPSCVLEGLDDYRCTACPRGYEGQYCERCSAGYT
GSPRSPGGTCQECECDPQGSLPLPCDPATGLCTCRPGATGPKCDGCQPGHARQGSECVFC
GDECTGLLLDDLARLEQMAMSINLTGPLPAPYKMLYGLENVTQELKHLLSPQRAPERLIQ
LAEGDLDTLVAEMSELLTRATKVTADGEQTGQDAERTNRRADSLGEFIKELAQDAEAVNE
KAVRLNETLGTQDKAFERNLQALQKEIDQMMTELRRRNLDKQKEVAEDELVAAEGLLKKV
KKLFGESRGKNEEMEKNLQATLADYKDKVDDAWDLLREAMDKIREANRLSAVNQKNMTTL
ERKKEAIERGKQQAENTLKEGNDLLDEANRLAGAINSVIEYVEDIQTKLPPMSEELKDKI
DDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFNAYSHIKDS
IDEAEKIAQEAKGLAHEATKLATGPQGSLKEGAKGSLQKSFGILNEAKKLANAVKENDDY
LNGLTTRLENADARNGDLLRALNDTLGKLSAIPNDTAAKLQAVKEKARQANDTAKDVLAQ
IKDLHQNLDGLKKNYNQLADSVAKTNAVVKDPLKNSKIFADAHDTVKNLEQEADRLIDKL
KPIKELEDNLKRNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIIVN
VKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIE
ASRTGRNGTISVRALDGPKASIVPSTYHAASPPGYTILDVDANAMLFVGGLTGKLKKADA
VRVITFTGCMGETYFDSKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSR
PIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELTDGHVKVSYDLGSGMASVVS
NQNHNDGKWKSFTLSRIQKQANISIVDINTNQEENIATSSSGNNFGLDLKADDKIYFGGL
PTLRNLSMKARPEVNLKRYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPK
PGFVELPPVPIDVGTEINLSFSTKNESGIILLGSGGMPAQPRRKRRQTGQAYYAVFLSKG
RLEVHLSTGTRTMRKIVIRPGPSGFHDGREHSVHVERTKGVFTVQVDEDGRHTQALPAEQ
AIQVHRLFVGGAPPEFQPPPLRNIPPFQGCVWNVVINSVPMDFAQPVSFKNADIGRCAHQ
KPREDEDAAVPAEAVTQPGPVPTPALPTPTPFGAHGPCAADPEPALLVGSKQFGLSRNSH
VAIAFDDTKVKNRLTIEFEVRTEAASGLLFYMARINHADFATVQLRHGLPYFSYDLGSGD
TNTMIPTKINDGQWHKIKIMRIKQEGILYVDDASNRTTSPKKADILDVVGMLYVGGLPIN
YTTRRIGPVTYSIEGCIRNFQMAEAPADLEQPTSSFHVGTCFARAQRGTYFDGTGFAKAV
GGFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAVYD
AGIPGHLCDGQWHKVTANKIKHRIELTVDGKQVEAQSPNQASTSADTNDPVFVGGFPDGL
NQFGLTTNVRFRGCIRSLRLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Download sequence
Identical sequences F1PVY5
ENSCAFP00000001563 ENSCAFP00000001563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]