SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001601 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001601
Domain Number 1 Region: 391-539
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-35
Family Third domain of FERM 0.0000146
Further Details:      
 
Domain Number 2 Region: 287-392
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-35
Family Second domain of FERM 0.00000527
Further Details:      
 
Domain Number 3 Region: 207-286
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-26
Family First domain of FERM 0.0000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001601   Gene: ENSCAFG00000001136   Transcript: ENSCAFT00000001740
Sequence length 928
Comment pep:novel chromosome:CanFam3.1:1:69131759:69224565:-1 gene:ENSCAFG00000001136 transcript:ENSCAFT00000001740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGLAAEVKQEPEKVGAAATERPKEAAENRQNPPSEPSEEPGLPPPAADSPGRPRQK
REGEPSESRGLARFLPPWLKKQKSYTLVAAGDKEPKEPPRAVVEQVAGPEESSPEGERPH
QAEAQERAGSRQQEVTAGVKDEKPEKPAASPEAQSAEEVGKGKEKVDEVQEDVSEEAAKR
ESKEVQTNELKAEKAAQKAAKKTKMVQCKVMLLDGTEYSCDLEKRAKGQVLFDKVCEHLN
LLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNFPWLFTFNVKFYPPDPSQLTEDLTRYL
LCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDHDPEEHGGGDLSDFQFAPMQTKELE
EKVAELHRTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYK
DRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVENR
IFFFVSPYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRV
SRSLDGAPLGVVEPGLVKDLPGAAGELPAGPGVGSAAAVQDGDGTRDLRSPAKAPHVQFV
EGKSSHETLNVVEEKKQAEVGKDERVIAEELNGKELSPGSGPGATRKVEPVTQKDSTSLS
SESSGGSESEEEDVGEYRPHHRVTPGTIREEQEEEEEEEEVEEGAGRAAQVVEREAPAPQ
GSPGSQAGASVSAVRAESQESPVAPGSPAEKRVDGGAAKQDGSEDAEDEQHKVNGEVSPV
DLDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAG
GDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAI
REAREQHPDMSVTRVVVHKETELDEGEE
Download sequence
Identical sequences F1PTI7
ENSCAFP00000001601 ENSCAFP00000001601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]