SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001853 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001853
Domain Number 1 Region: 808-916
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-22
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.15e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 278-398
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.37e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 625-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000209
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 5 Region: 240-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000544
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 160-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000355
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 201-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000062
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001853   Gene: ENSCAFG00000001298   Transcript: ENSCAFT00000002005
Sequence length 993
Comment pep:novel chromosome:CanFam3.1:12:4396644:4416666:1 gene:ENSCAFG00000001298 transcript:ENSCAFT00000002005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGRVPGLCLLVLLVHARAAQHSRAAQDVDECVEGTDSCHIDALCQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHVKFVLHTDGKTCIETC
AVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGSFE
CSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHHGYLLYGVTHCGDVDE
CSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPVKCQSSPGASKAMLSCNRSG
KKDTCALTCPSRARFLPESENGFTVSCGTPSPRATPARAGHIGNSTNSNHCHEAAVLSVK
QRASFKIKDAKCRLHLRNKGKMEEASRILGQGGAPCSDCQVTFIHLKCDSSRKGKGRRAR
TPPGKEVTRLTLELEAEVRAEETTAACGLHCLRQRMERRLKGSLKMLRKSINQDRFLLRL
AGLDYELAHKPGPGAGDRAELVEVCRPGQHRAGAKCVSCPQGTYYHGQTEQCVPCPAGTF
QEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCSPGQYSVDGFKPCHPCPRGTYQPEAGR
TLCFPCGGGLTTKHEGAVSFQDCDTKVQCSPGHYYNISIHRCIRCAMGSYQPDFRQNFCT
RCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECVWNINPPPKR
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKT
SEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQ
NYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences J9NYF9
XP_538874.3.84170 ENSCAFP00000038328 ENSCAFP00000001853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]