SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002886 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002886
Domain Number 1 Region: 234-410
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 519-630
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-16
Family Second domain of FERM 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000002886
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.032
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002886   Gene: ENSCAFG00000001961   Transcript: ENSCAFT00000003109
Sequence length 736
Comment pep:known chromosome:CanFam3.1:14:17836930:17868973:-1 gene:ENSCAFG00000001961 transcript:ENSCAFT00000003109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
NSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREAALFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGD
SELLNRLLNERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEIDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHIRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKKIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYGCFMWQLGDADTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS
Download sequence
Identical sequences J9NZT0
XP_005628564.1.84170 XP_005628565.1.84170 XP_005628566.1.84170 XP_539416.2.84170 ENSCAFP00000002886 ENSCAFP00000038800 9615.ENSCAFP00000002886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]