SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003148 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003148
Domain Number 1 Region: 41-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.63e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 729-755,790-943
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-37
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 176-371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.83e-37
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 4 Region: 342-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-35
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 5 Region: 974-1177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.81e-23
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 6 Region: 553-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000559
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003148   Gene: ENSCAFG00000002155   Transcript: ENSCAFT00000003391
Sequence length 1294
Comment pep:novel chromosome:CanFam3.1:1:94532747:94694749:-1 gene:ENSCAFG00000002155 transcript:ENSCAFT00000003391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTSLLWNVLNLVLQCLTPSKSWFPRYGAIKPDNCDAALASTLPREAFSSSSELSSSHGPG
FASLNRRDEGAGGWSPLVSDQYQWLQIDLGERMEVTAVATQGGYGSSDWVTSYILMFSDG
GRNWKQYRHEESISGFPGNTNADSVVHYRLQPPFEARFLRFLPLAWNPKGRIGMRIEVYG
CAYRSEMVNFDGKSSLLYTFNQKSVSPTKDVISLKFKTRQTDGILLHREGQNGKYITLEL
VKGKLILSLNSGHANLPSPDARVTLTLGSLLDDHHWHSVRIDLLNTQVNFTVDRHTQHFQ
AKGKSSYLDLDYEISFGGIPGHRKAVAFPHKNFDGCFENLYYNGVDIIDLSKKHKPQILI
MGNVSFSCSHPQIVPVTFLSSRSYLALPGVAGEDKVSVAFQFRTWNRAGLLLTTQLRHGP
GALTLVLDDGKLKLSLSQPGHPARDVTAGAALSDGQWHLVSLSLKGNHLSVMVDGEAASV
AHSLRGKIDSGDTYYLGGCPDSSSGPGCGGALAGFQGCLRLISIGDQEVDPITVQQGTLG
RFRDLQIDSCGLMDRCLPSYCEHGGECSQSWDTFSCDCAHTGYTGATCHSFLRERRCRFY
KQGGSMTETGYWHSCIPGSLSPFTKKCCKLQKDTTWTSVQHNGSHLARIKSSNGEGPRPV
FFKYTASMEQLQAIIDRADHCQQELAFHCKRSRLSTRHDGTPVSWWVGRTNETHTYWGGS
LPDAQKCACGLQGNCLDSQYHCNCDADRNEWTSDTVVLSHKEHLPVTQVAMRDTGQPHSE
AAYALGPLLCQGDNSFWNSASFNTETSYLHFPTFRGELSADVSFFFKTTAPSGVFVENLG
ITDFIRLELQAPAEVTFSFDVGNGRCEVTVRSPTPFNDDRWHHVRAERNVKEASLQVDQL
PTRTQPAPADGHARLQLNSQLFVGGTATRQRGFLGCIRSLRLNGLALDLEERATMTPGVE
PGCPGHCSSYEHLCRNGGRCRERPRGVACDCAFSAYEGPFCESVMLEVVSWKQHWEETLL
EDIRLHLRSSLAAIFHEDLTLAGEIATLSFRTTGTPSLLLYVSSFYEEYLSVILAPNGSL
QIRYKLDKHHEPDVFNFGFKNLADGQLHQVKIHREAAVVSVEVNQNARRQVILSSGTEFN
AVKSLMLGTILEPPGADPDTLRAGARGFTGCLSAVRFGPAAPLKAALRPGGPAPVTVTVR
GPVAAATRCAEGAGPGAPAREATGPLAGGAGGSGPTDGGQPLVNADRSDSAVIGGVIAVV
IFILLCITAIAIRIYQQRWLYQKNESNIPQTGDN
Download sequence
Identical sequences F1PSE5
ENSCAFP00000003148 ENSCAFP00000003148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]