SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003633 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003633
Domain Number 1 Region: 598-662,700-798
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-31
Family Pleckstrin-homology domain (PH domain) 0.0081
Further Details:      
 
Domain Number 2 Region: 804-922
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 1216-1349
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-19
Family Second domain of FERM 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000003633
Domain Number - Region: 1118-1197
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000127
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 27-120,705-725
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000418
Family BAR domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003633   Gene: ENSCAFG00000002489   Transcript: ENSCAFT00000003931
Sequence length 1493
Comment pep:novel chromosome:CanFam3.1:10:46113651:46226405:1 gene:ENSCAFG00000002489 transcript:ENSCAFT00000003931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSETEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAF
QQVQVMEEKLKAANIQTSESETRLYKKCQDLETLIQEKDDIIQNLELQLEEQKQIRIQEA
KIIEEKAAKIKEWVTLKLNELELENQNLRLINQNQTEEIRTIQSKLQEVQGKKSSSVSTP
KLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEGKDIEEMEIPEKSGEN
QIQENNRGQRTLHQTPCVPEQNQNTRTSFATDGGTSQNSGAPGSDWSSDEEDESKGRSKC
RYTSTLSSHTSEEGVQCSRMGSEVYLTASDDSSSIFEEETFGIKRLEHKKLYSWQQEAQW
KAQNCPLIKGNSESSKKEHDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALTPKHP
NSLPGRGTQLASSSYLPPPKLRIPNVFSISVALAKRHLSQPQLSSDRMFGTNRNAISMIR
PLRPQETDLDLVDDDSTDILENMDTSCDDGLFSYDSLESPCSDDQETCEVAKKPACSKPP
TPPLHRFPSWESRIYAVAKSGIRMSEAFNMENVNKNSVALLSYTTSGLYTSLIYKNMTTP
VYTTLKGKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDTRSRSGPGSPRAMKRGVSLS
SVASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKTW
KRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTAD
SPNILEEWIKVLQNVLRVQAANPLFLQPEGKPTVKGLLTKVKHGYSKRVWCTLIGKTLYY
FRSQEDKFPLGQIKLWEANVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLL
IGSKHEKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIEGEPSSQIWRHPTLCHSKEGI
ISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEI
CCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKY
AIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDAS
TTVEEFLNTLNQDTGMRKPTQSGFALFTDDPSGKDLEHCLQGNIKICDIISKWEQASKEQ
QPGKWEGTRTVRLTYKNRLYFSMQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMA
ALLAQVEIGDFERPFSTPAGHVTNQCKTNQTLKQVIEKFYPKRYRDDSSEEQLRQLCQRL
STRWMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPITPSALGSTFMWLAIHEDGLSI
LEYNSMRLIVSYVYKSLMTFGGHQDDFMIVINNTHSKDKPTEKLLFAMAKPKILEITLLI
ASYINNFHQQKAAFHHLSAPALLSAQTRGPEARAVGSQPLLSSSRPTKGPTLL
Download sequence
Identical sequences F6Y875
ENSCAFP00000003633 XP_013972974.1.84170 XP_538474.3.84170 ENSCAFP00000003633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]