SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004253 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004253
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.26e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000739
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 3.04e-35
Family Third domain of FERM 0.00019
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-32
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 4 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-19
Family First domain of FERM 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004253   Gene: ENSCAFG00000002868   Transcript: ENSCAFT00000004599
Sequence length 913
Comment pep:known chromosome:CanFam3.1:11:64489932:64592132:-1 gene:ENSCAFG00000002868 transcript:ENSCAFT00000004599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINSIRTSELPKEKTRSEIVCSIRFLDGLVQTFKANKQDTGQVLLDMAYN
HLGVTEKEYFGLQHGDDSVDSLRWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSQFIPDQ
NDDFLTKVESLHEQHSGLKQSEAESCFINIARTLDFYGVELHGGRDLHNLELMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNLKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSESEVSQNRSPHRESISENNPAQSCLTQKSSSSVSPSSNAPGSCSPEGVDQQFLED
FHRVTKGGSTEDSSQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRKAVH
SFTDIKSDDELNQLFPEAIFPICPEGGDTLEGSMDQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASSVNMEIPAANLVNKYIAAQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMEHGNFHIRCQSEDCT
LAYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRADGEPMLV
HCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
Download sequence
Identical sequences E2QXI8
XP_005626967.1.84170 XP_853516.1.84170 ENSCAFP00000004253 ENSCAFP00000004253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]