SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005191 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005191
Domain Number 1 Region: 13-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.74e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 126-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-38
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 337-528
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-34
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 4 Region: 554-612
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000335
Family Fibrinogen C-terminal domain-like 0.003
Further Details:      
 
Domain Number 5 Region: 525-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000894
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005191   Gene: ENSCAFG00000025531   Transcript: ENSCAFT00000005604
Sequence length 669
Comment pep:novel chromosome:CanFam3.1:16:2728962:3641896:-1 gene:ENSCAFG00000025531 transcript:ENSCAFT00000005604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSEKCDEPLVSGLPHVAFSSSSSMSGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFG
NRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDSVVRHDL
QHPVIARYVRIVPLDWNGEGRIGLRIEVYGCSYWADVINFDGHVVLPYRFRNKKMKTLKD
VIALKFKTSESEGVILHGEGQQGDYITLELKKAKLVFSLNLGSNQLGPIYGHTSVMTGSL
LDDHHWHSVVIERQGRSINLTLDRGVQHFRTNGEFDYLDLDYEITFGGIPFSGKPSSSSR
KNFKGCMESINYNGINITDLARRKKLEPSNVGNLSFSCVEPYTVPVFFNATSYLEVPGRL
NQDLFSVSFQFRTWNPNGLLLFSQFAENLGNVEIYLTESKVGVHINITQTKMSQIDISSG
SGLNDGQWHEVRFLAKENFAVLTIDGDEASAVRTNSPLQVKTGEKYFFGGFLNQMNNSSH
SVLQPSFQGCMQLIQVDDQLVNLYEVAQRRPGSFANVSIDMCAIIDRCVPNHCEHGGKCS
QTWHSFQCTCEETGYSGATCHNSIYEPSCEAYKHLGQTSNYYWIDPDGSGPLGPLKVYCN
MTEDKVWTIVSHDLQMQTTVVGYSPEKYSVTQLVYSASMDQISAVTSSAEHCEQYVSYFC
KMSRLLNTP
Download sequence
Identical sequences F1PCK3
ENSCAFP00000005191 ENSCAFP00000005191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]