SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005643 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005643
Domain Number 1 Region: 276-427
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000062
Further Details:      
 
Domain Number 2 Region: 430-587
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.27e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000705
Further Details:      
 
Domain Number 3 Region: 647-805
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-36
Family MAM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 148-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-33
Family Spermadhesin, CUB domain 0.00000136
Further Details:      
 
Domain Number 5 Region: 28-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005643   Gene: ENSCAFG00000003776   Transcript: ENSCAFT00000006098
Sequence length 925
Comment pep:known chromosome:CanFam3.1:2:3415993:3551319:1 gene:ENSCAFG00000003776 transcript:ENSCAFT00000006098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGPPLLSAALAVAVAVALAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLI
QAPDPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENENGRPWGKFCGKIAPSPVVSSGPF
LFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPSGVIKSPGFPEKYPNGLECTYIIF
APKMSEIILEFESFDLELDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRS
SSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYS
TNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTY
RIDISSNGEDWITIKEGNKPVIFQGNTNPTDVVFAVFPKPLITRFVRIKPMTWETGISMR
FEVYGCKITDYPCSGMLGMVSGLISDSQITASNQGERNWMPENIRLVTSRSGWTLPPAPH
PYINEWLQVDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWRMIMDDSKRKAK
SFEGNNNYDTPELRTFPPLSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGN
LVDECDDDQANCHSGTGDDFQLTGGTTVLTTERPTVIDSTIQSEFPTYGFNCEFGWGSHK
TFCRWEHDNQVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNS
AHCMTFWYHMSGSHVGTLRVKLHYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQ
VIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPSDLDKRNPENKIDETGSTPGYEGTGE
GDENISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALEN
YNFELVDGVKLKKDKLNTQSTYSEA
Download sequence
Identical sequences F6UNY1
ENSCAFP00000005643 XP_535142.3.84170 ENSCAFP00000005643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]