SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006616 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006616
Domain Number 1 Region: 43-810
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.31e-277
Family Motor proteins 0.000000000205
Further Details:      
 
Domain Number 2 Region: 1918-2034
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-21
Family Second domain of FERM 0.0042
Further Details:      
 
Domain Number 3 Region: 2035-2124
Classification Level Classification E-value
Superfamily PH domain-like 8.52e-20
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 4 Region: 1218-1320
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000472
Family Ubiquitin-related 0.034
Further Details:      
 
Domain Number 5 Region: 1818-1926
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000403
Family Ras-binding domain, RBD 0.046
Further Details:      
 
Domain Number 6 Region: 1312-1412
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000641
Family Second domain of FERM 0.0067
Further Details:      
 
Domain Number 7 Region: 1531-1594
Classification Level Classification E-value
Superfamily SH3-domain 0.00000015
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 8 Region: 815-879
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000491
Family Motor proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006616   Gene: ENSCAFG00000004404   Transcript: ENSCAFT00000007148
Sequence length 2143
Comment pep:novel chromosome:CanFam3.1:19:22979381:23044911:-1 gene:ENSCAFG00000004404 transcript:ENSCAFT00000007148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFRLGDHVWLNPLSANKTSVAIGSIVKETKPGKILVVDDEGKEHWIQAKDLDTLSPMH
PNSVQGVDDMIRLGELNEAGMVHNLLIRYRQHKIYTYTGSILMAVNPFQVLPLYTLEQVQ
LYYNRHMGELPPHVFAIANNCYFNMKRNKRDQCCIISGESGAGKTETTKLILQFLATVSG
QHSWIEQQVLEANPILEAFGNAKTVRNDNSSRFGKYIDIHFNPNGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYGMLLGMTAEEKKLLSLGTPSEYHYLTTGNCTSCEGLNDAKDYAH
VRSAMKILMFSDSENWDLSKLLAAILHLGNVEFMAAVFENLDSSDVMETPAFPTVLKLLE
VEYQALRDCLIKHSIIIRGEFVTRPLNITQAADRRDAFVKGIYGHLFLWIVKKINTAIFT
PPAQDPKNVRRAIGLLDIFGFENFQNNSFEQLCINFANEHLQQFFVQHVFTMEQEEYLSE
NIAWDYIHYNDNRPTLDLLALKPMSIISLLDEESHFPQGTDTTMLQKLNSVHANNKAYLQ
PRNIHDARFGIAHFAGEVYYQTEGFLEKNRDMLSTDILTLVYSSKNKFLKEIFKLESAGT
KLGQSTIIQASAGSQLFKSADSSKQPSTLAGQFKKSLDQLMKILTSCQPYFIRCIKPNEY
KKPLLFDRDLCLRQLRYSGMMETVHIRRSGFPIRYTFQEFAQRFGVLLPSAVRLQLRDKA
RQMTLRIAEMQLGTDKEWKVGKTKIFLKDNQDTLLEVQRTQTLDKAAINIQRVLRGYKYR
KEFLRQRRAAVTLQARWRGYYNKRNFKQILLGFERLQAIARSQWLAKQYQTMRQRMVQLQ
ALCRGYLVRQQVQAKRRAVVVIQAHARGMAARRNFQQQKANGPLVIPAEGQKSQSILPTR
KRKSIYDTITDTEMVEQVFGFLPSMIGGQEGQAPWRFEDLEAKSQKLPEVDLDTVPLVEE
SEDDVDGLAEYTFPKFAATYFQKSASHTHIRRPLRYPLLYHEEDADCSAALAVWNIILRF
MGDLPEPVLFARNGPPGGSVTRQIRDSLGREGGTRSPPHCGSTQKSSRRDRGSKDISSMK
LKRSSKITSQVTSQLNIGEEAFEPDGPISDRPMSNLEKVHFIVGYAILRPNLRDEIYCQI
CKQLSENFKTSCLARGWILLSLCLGCFPPSERFMKYLLNFIGQGPAGYGPFCAERLRRTY
ANGVRTEPPTWLELQAVKSKKHIPIHVILVTGESLTVMVDSASTSREVCLHIAHKQGLSD
HLGFSLQVAVYDKFWSLGSGRDHVMDTVAQCEQLARDRGENERQSPWRIYFRKEFFTPWH
DSQEDPVSTQLIYRQVLHGVWSGEYNFEKEDDLVQLLAKHCYVQLGASVGSEAVQELLPS
CIPSKLYKTKPPEKWASLVTAAHAKAQYTQKQAKPLAVQEQVVDTARLQWPLLFSRLFEV
TTLSGPRLPKTQLILAVNWKGMYFLDQREKILLELSFPEVVSLITNREAQGGQRLVLSTL
HEEEYKFMSPSSVAIAELVAMFLEGLKERSVFAMALQNRKATDDTTILPFKKGDLLILTK
KQGLLASENWTLGQNDRTGKTGLVPTACLYTIPTVTKPSAQLMSLLAMSPEKRKLAAQEV
QPTEPLPEEQPKEKPHTLEEFSYEFFRAPEKETVRRTMLPLARTQGHLWAHSSEPLRQPL
LKQVHANAELRDPACQIFIGILRYMGDYPSRQAWTSVELADQIFSLALQESALRDEVYCQ
ILKQLTHNTTRYSEERGWQLLWLCTGLFPPGKALLPHAQKFVDTRRKKLLAPDCSRRIQR
ILRTGPRKQPPHPVEVEAIEQNISRICHKIYFPNDTSEMLEVGTYTRVRDVCQGIATRLQ
LSSWEGCSLFIKIADKVISQKEGDFFFDSLRQVSDWVKKNKPQKEGAPVTLPYQVYFMRK
LWLNVTPGKDVNADTVLHYHQELPKYLRGFHKCSQEDAVHLAGLIYKAQFDNNRSQLASI
PKILRELVPENLTRLMSSEEWRKNILLAYDKHKDKTVEEAKVAFLKGICRWPTFGSAFFE
VKQTSEPSYPDIILIAINRHGVLLIHPKTKELLTTYPFTKISSWSSGSTYFHMALGSLAR
GSRLLCETSLGYKMDDLLTSYVQQLLSAMNKQRGSQTPALADP
Download sequence
Identical sequences J9JHP0
ENSCAFP00000035971 ENSCAFP00000006616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]