SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006833 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006833
Domain Number 1 Region: 1387-1503
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-36
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 2 Region: 928-1037
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 3151-3276
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-35
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 4 Region: 2685-2796
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 5 Region: 1161-1273
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-34
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 6 Region: 1049-1155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-34
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 7 Region: 1622-1730
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 8 Region: 586-698
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-34
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 9 Region: 1735-1845
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 10 Region: 2449-2561
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 11 Region: 3398-3503
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-33
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 12 Region: 2225-2330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-33
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 13 Region: 2332-2443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-32
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 14 Region: 3033-3145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-31
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 15 Region: 1279-1384
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-28
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 16 Region: 1987-2086
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-28
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 17 Region: 3507-3618
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 18 Region: 820-924
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-28
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 19 Region: 1854-1961
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-27
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 20 Region: 2088-2209
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-26
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 21 Region: 467-582
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 22 Region: 2567-2683
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 23 Region: 2912-3031
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-25
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 24 Region: 703-815
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-21
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 25 Region: 2801-2914
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-21
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 26 Region: 1506-1561
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 27 Region: 3274-3387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-18
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 28 Region: 130-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.01
Further Details:      
 
Domain Number 29 Region: 429-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000655
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 30 Region: 389-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.014
Further Details:      
 
Domain Number 31 Region: 257-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000033
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 32 Region: 180-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000542
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000006833
Domain Number - Region: 210-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.069
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006833   Gene: ENSCAFG00000004568   Transcript: ENSCAFT00000007375
Sequence length 3620
Comment pep:known chromosome:CanFam3.1:2:19784198:20041500:1 gene:ENSCAFG00000004568 transcript:ENSCAFT00000007375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPFLWSLIILLTFAESNGEAGGFELQRQKRSIDFQQPRMATERGNLVFLAGSAQNIEF
RTGSLGKIKLNEEDLGECLHQIQKNKEDITDLKRSAVNVPQNISSQIHQLNSKLVDLERK
FQSLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPSQWKGPLCSVDVNECQIYSGTPLG
CQNGATCENTAGSYSCLCSPETHGPQCASKYDDCEGGSKALCVHGICEDLVRVKADEPKY
NCICDAGWTSPLNSSACVLDIDECNLQHAPCSPLVQCFNTQGSFYCGACPTGWQGNGYSC
QDIDECKINNGGCSVVPPVMCVNTLGSYHCQACPPGYQGDGRVCTVIDICSVNNGGCHPE
ASCSSVLGSLPLCTCLPGYTGNGYGPNGCAQLSDTCLSHPCLNGQCIETVSGYLCKCESG
WAGINCTENINECLSNPCFNGGTCVDGVNAFSCECTRFWTGFLCQIPQQVCGGSLSGMDG
SFSYMSPDVGYVHDVNCFWVIRTEDRKVLRITFTFFQLESVNNCPHEFLQIHDGDSSAAL
QLGRFCGSVLPHELLSSNNALYFHLYSEHFRSGRGFTIRWETQQPECGGILMGTYGSIKS
PGYPGNYPPGRDCVWQVVTSPDLLITFTFGTLSLEHHDDCSKDYLEIRDGPLYQDPSLGK
FCTTLSVPPLQTTGPFARVHFHSDNQINDQGFHITYLTSPSDLHCGGNYTDPEGLLSSDL
SGPFTHNRQCIYIIKQPLGEQIQVNFTHVELEGQSSCSQSHIEVRDDKILLGKVCDNETL
PHIKSIRNHIWIRLKIDASLVRASFRAVYQVACGGELTGEGVIRSPFYPNVYPGERICRW
TIHQPQSQVVILNFTAFGIESSAHCDTDYIEIGSSSILGSPENKKYCGTDIPLFITSVYN
FLYVIFVKSSSTENHGFMAKFSAADLACGEILTESTGIIQSPGHPNIYPHGINCTWHILV
QPGHLIHLIFRKFHLEFHYNCTNDYLEVYDTGSNTYLGRYCGKSIPPSLTSSTNSLKLIF
VADSDLAYEGFLINYEATDASSACMEDYTENSGTFTSPNFPNNYPNNWKCIYRITVETSQ
QIALHFTNFALEEAIGGQCVADFVEIRDGGYETSPPLGTYCGSIPPPRIISHSNKLWLQF
TSDFLGSGPGFSAYWDGSLTGCGGNITTPTGVFTSPSYPMPYYHSSECYWLLKASHGSPF
ELEFEDFHLEHHPNCTLDYLAVYDGPSTSSHLLSQLCGNEKPPVIRSTGDSMFLKFRTDE
DQQGGGFLAKYQQTCRNVVIVNRNYGILESIHYPNPYSDNQRCNWTIQATTGNTVNYTFL
AFELENHINCSTDYLELYDGPRRMGRYCGADMPPTGSTTGSKLQVLFYTDGVGHQEKGFQ
MQWFIHGCGGELSGTTGSFSSPGYPNTYPPNKECIWYITTAPGSSIQLTIHDFDVEYHAR
CNFDVLEVYGGPDFHSPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSINGRGFNASW
QAVPGGCGGIFQAPNGEIHSPNYPSPYRGNTDCSWVIRVERNHRILLNFTDFDLEPQDSC
ITVEEALRSRGTSMESVKIRDNLLSCADSFGSILILKRRASGSRRGRGAPGYFREICGGH
ILTNSFDTISSPLFPAKYPNNQNCSWVIQAQPPFNHITLSFDHFGLESSTTCTQDFLEIL
DGDYDDAPLRGRYCGTSMPHPITSFSSALTLRFVSDSRVNSDGFHATYAASSSACGGTFH
MAEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQDCSRDFVEVREGNA
TGHLVGRYCGNVLPLNYSSIVGHILWIRFVSDGSGSGTGFQATFTKIFGNDNIVGTHGKI
ASPLWPGRYPHNSNYQWIVNVNATQVIHGRILEIDIEGAQSCYYDKLRVYDGLGIHSRLI
GTYCGTQTTSFSSSRNSLTFQFSSDSSITGKGFLLEWFAVNASGGPLPTIATGACGGFLR
TGDAPVFLFSPGWPESYSNSADCTWLIQAPDSTVELNILSLDIEAQRTCDYDKLVIRDGD
SNLAPQLAVLCGREIPGPIRSTGEYMFIRFTSDFSITGAGFNASFHKSCGGYLHADRGII
TSPQYPETYSPNLNCSWHVLVQSGLTIAVHFEQPFQIPSGDSSCSQGDYLVLKNGPDIYS
PPLGPYGRNGHFCGSRPSSTLFTSDNQMFVQFISDGSNGGQGFKIKYEAKSLACGGNIYI
HDVNSAGYVTSPGHPNNYPQHADCNWLIAAPPGKLIRVQFEDQFNIEETPNCVSNYLELR
DGVDSNAPLLAKLCGRSLPSSQLSSGEVMYLRFRSDNSSTQVGFKIKYAIAQCGGRVTGQ
SGIIESSGYPTLPYRDNSFCEWHLKGPSGHYLTIHFEDFHLQNSSGCEKDFVEIWENHTS
GNLLGRYCGNTIPDSIDTSSNVALVRFVTDGSVTASGFRLWFESSMEACGGELQGPTGTF
TSPNYPNPNPHGRVCEWRIMVQEGRRITLTFNNLRLEAHPSCYSEHVTIFNGIRNNSPQL
EKLCGSVNASSEIKSSGNTMKVVFFTDGSRPFGGFSATYTSSEDAVCGGSLTHFPEGNFT
SPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFEDFYLESHQDCQFDVLEFRVGNADGP
LMWRLCGPSKPIVPLVIPYPEVWIHFVTNEHVEHVGFHAEYSFTDCGGIQLGESGVIASP
NYPASYDSLTHCSWLLEAPQGFTITLTFSDFDIEDHATCAWDSVSVRNGGSPGSPIIGQY
CGTSNPRTIQSGSNQLVVIFNSDHSVQNGGFYATWNTQTLGCGGILHSDNGTIRSPHWPQ
NFPENSRCSWTVITHESKQLEISFDNNFRIPSGDGQCQNSFVKVWAGTEEVAESLLATGC
GNVAPGSILTPRNVFIAVFQSQETPAQGFSASFVSRCGGNFTNPSGYILSPNYPRQYDNN
MNCTYIIEADPLSVVLLTFESFHLEARSAITGSCANDGVHIIRGSNLSSTPFATVCGNEI
LSPVTILGPVLLNFYSNAHTTDLGFKFNYKITSCGGVFNVSTGVIKSPAYSYSDYPNNIY
CLYTIVGRDDRVVQLKFSDFDVVPSTFCSQDYLAIYDGSNISDPLLGKFCGSNLPPNIKS
SNHSMLLVFKTDSFQTARGWKITFQQTLGPQQGCGGYLTGSDNTFASPDSDSNGRYDKNL
NCVWFIIAPVNKLIKLTFNTFALEAQSAMQRCIYDYVKLYDGDSENANLAGTFCGSTVPA
PFISSGNFLTVQFVSDVTLEREGFNATYTTVDMPCGGTYNATWTPQSISSPNSSNPEVPL
SMCMWVLEAPPHQQVKITVWALELHSQDCDQNYLEFRDSPESNGSPGPQICGRNASATPT
FYSSRSTAIVIFKSEVLNRNSRVGFTYQIAGCNREYNKAFGNLKSPGWPDNYDNNLDCTV
ILTAPQNHTISLFFHSFGIEDSSECTHDFLEVRNGSDSSSPLFGTYCGTLLPDPIFSRNN
KLYLRFKTDSATSNRGYEIVWTSSPSGCGGTLYGDSGSFTSPGYPGTYPNNTDCEWAIIA
PAGRPVTVTFYFISIDDPGDCVQNYLILYDGPDANSPSFGPYCGADTNIAPFVASSHRVF
IKFHAEYAVYPSAIRLTWDS
Download sequence
Identical sequences F1PK03
ENSCAFP00000006833 9615.ENSCAFP00000006833 ENSCAFP00000006833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]