SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007208 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007208
Domain Number 1 Region: 1503-1766
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-39
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 210-497
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-37
Family Kelch motif 0.0047
Further Details:      
 
Domain Number 3 Region: 36-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-22
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1210-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 5 Region: 1073-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000293
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 1162-1210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000007208
Domain Number - Region: 2195-2245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 2123-2158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000349
Family EGF-like domain of nidogen-1 0.089
Further Details:      
 
Domain Number - Region: 2289-2324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00276
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 2470-2480
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 483-534
Classification Level Classification E-value
Superfamily Kelch motif 0.00902
Family Kelch motif 0.032
Further Details:      
 
Domain Number - Region: 1296-1400
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.011
Family Spermadhesin, CUB domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007208   Gene: ENSCAFG00000004824   Transcript: ENSCAFT00000007776
Sequence length 2787
Comment pep:novel chromosome:CanFam3.1:1:112021960:112062381:-1 gene:ENSCAFG00000004824 transcript:ENSCAFT00000007776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGSALAVALALPLALLGPLFPGARAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSPQHRILLDFLFLDTECTYDYLFVYGDSPRGPLLASLSGSTRPPPIEASSGKMLLH
LFSDANYNLLGFNASYRFTLCPGGCSGHGQCQAPGVCTCEPGWGGPDCSLQECPAYCGSH
GTCASPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSAGDPAFSARIGAAGAFLSPPGL
LAVFGGQDLNSALGDLVLYNFSANTWERWDLSPAPAARHSHVAVAWAGSLVLMGGELANG
SLTSDVWAFSPLDGGHWELLAPPVLSSSGPPGLAGHAAALVDDIWLYVSGGRTQHDLFSS
GLFRFRLDSTSGGYWEQVVPAGGRPPAATGHSMVFHAPSRTLLVHGGHRPSTARFSVRVN
STELFHVDRRVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDGL
FFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDLM
AYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTPSGECPAAS
CLGLGRLLGDCQACLAFSSPTAPPRGPGALGWCVHNESCLPRPEQARCRGEQISGTVGWW
GPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNASQPDKVLIVRSTTITLTPSPETDVSLV
YRGFIHPLLPGGPGGPGAEDVAVWARAQRLHVLARMARGPDTENMEEVGRWVAQQEKETR
RLQRPGSARLFPLPGRGHKYAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFLE
PYRSSACSSYSSCLGCLADQGCGWCLTSATCHLRQSGAHCGDDGAGGSLLVLVPALCPLC
EEHRDCHACTQDPFCEWHQSTNRKGDAACSRRGRSRGALKSPEECPPLCSQRLTCDDCLA
NSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCDRFLTCHECLQSHEC
GWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLSVALPARWAYARCPDVDECRLG
LARCHLRATCLNTPLSYECHCQRGYQGDGITYCNRTCLEDCGHGVCSGPPDFTCVCDLGW
TSDLPPPTPAPGPPAPRCSRDCGCNFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSFGN
ATGSGGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQFCSPGYYGDPRAGGSCFR
ECGGRALLTNVSSVALGSRRVGGLLPPGGGAARAGPGLSYCVWVVSATEVLQPCAPGTLC
PPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQALS
GLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECIPQDGATGAGLCRCPQGWAG
PHCRMALCPENCNAHSGAGTCNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLSA
DTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGGP
GPSPRSFHAAAYVSSGRGAMYLLGGLTAGGVARDFWILNLTTLQWRQEKVPQTVELPAVA
GHTLTSRRGLSLLLVGGYSPESGFNQQLFEYQLVTGTWVGAQSGTPPTGLYGHSAVYHEA
TDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKPRPRLFHASALLGDTMV
VLGGRSDPDEFSSDVLLYQVNCNAWLLPDLTRPASVGPPMEESVAHAVAAVGGRLYLSGG
FGGVALGRLLALTLPPDPCRLLPSPEACNQSGACTWCHGACLSGDQAHRLGCGGPPCSPM
PRSPEECRRLRTCSECLARHPRTLQPGDGEASAPRCKWCTNCPEGACIGRNGSCTSENDC
RINQREVFWAGNCSEAVCGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFS
HSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQQCLSPSYL
PLRCMAGGCGRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGGGHCLEGGLSGP
RDGLTCGRPEASWAFLSCPPEDECANGHHDCNETQNCHDRPHGYECSCKAGYTMDNVTGL
CRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCRNHTK
GSHCEQCLPLFVGSAVGGGTCRPCHAFCRGNSHVCVSRKELEMARKEPEKYPLDPEEIEN
WVTEGPSEDEAVCVNCQNNSYGDKCESCLHGYFLLDGKCTKCQCNGHADTCNEQDGTGCP
CQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPTSQ
TNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPD
TGVHTVHIQPPPPPPPPPPPADGGPRVAGDPGGPGAGNGPGTPAEPRVREVWPRGLITYV
TVTEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLLF
FRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRPFA
KVTVCFPPDPAAPAPAWKPAGLPPPTFRRSEPFLAPLLLTGAGGPWGPVGGGCCPPAIPA
TTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPQAPNGACLGSALVTLRHRLHEYCGGGG
GAGGSGHGAGAGRKGLLSQDNLTSMSL
Download sequence
Identical sequences E2RM39
ENSCAFP00000007208 ENSCAFP00000007208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]