SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007275 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007275
Domain Number 1 Region: 623-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000849
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-36
Family Second domain of FERM 0.0000724
Further Details:      
 
Domain Number 4 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.1e-23
Family First domain of FERM 0.0012
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-20
Family PDZ domain 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007275   Gene: ENSCAFG00000004872   Transcript: ENSCAFT00000007849
Sequence length 926
Comment pep:novel chromosome:CanFam3.1:19:30086832:30241064:-1 gene:ENSCAFG00000004872 transcript:ENSCAFT00000007849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASFAVQSELGDYNQSDNLSGYLSDYSFIPNQ
PQDFEKEIAKLHQQHTGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKEVHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLV
DHVVHTSPSEVFVNHRSPSSTQANSIVLESSPSQETPGDGQPPALPPKQSKKNSWNQIYY
SHSQQDLENHISETFDVPSSPEKSTPNGGIPQDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCETHSGELVLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSIHQDDHSLRESMIQLAEGLVTGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYIFRKMTLFNQEKNESRQLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPIVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences F1PAF5
ENSCAFP00000007275 ENSCAFP00000007275 XP_541002.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]