SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007620 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007620
Domain Number 1 Region: 111-177
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000801
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Domain Number 2 Region: 282-365
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000227
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000007620
Domain Number - Region: 241-286
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.016
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 
Domain Number - Region: 173-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0345
Family Nucleotide and nucleoside kinases 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007620   Gene: ENSCAFG00000005116   Transcript: ENSCAFT00000008227
Sequence length 369
Comment pep:known chromosome:CanFam3.1:16:19236966:19282596:1 gene:ENSCAFG00000005116 transcript:ENSCAFT00000008227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKNKGHSSKRGNLAVTAVALQDHILHDLQLRNLSTTDHSKTKAQKRESRSKSLKGNTKA
IIDTGLKTTLQDPKVEDPEKEYVLDPKPPPLTLAQKLGLFEPPPPLLSSDEWEKVKQRSI
LQGDSMQPCPICKEEFELRPQVLLSCSHVFHRACLQAFEKFTNKKTCPLCRRNQYQTRVI
HDGARLFKTKCATRIQAYWRGHVVRKWYQDLRRTVPPTDAKLRRKFFEEKFTEISHRILC
SYNTDIEELFSEIDHCLAINRSILQQLEDRCSHELTEEDWEKIQIQALHRETYECPICLT
PLPGSGDSHQDASGMRCSQTSRETVLLSCSHVFHHTCLLALEEFSLGDCSPFHACPLCRS
CYQKKILGY
Download sequence
Identical sequences E2RF22
XP_005629765.1.84170 XP_539933.3.84170 ENSCAFP00000007620 ENSCAFP00000007620 9615.ENSCAFP00000007620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]