SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007700 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007700
Domain Number 1 Region: 41-796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-280
Family Motor proteins 0.000000000118
Further Details:      
 
Domain Number 2 Region: 1956-2072
Classification Level Classification E-value
Superfamily Second domain of FERM 1.09e-22
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 1252-1355
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.21e-20
Family First domain of FERM 0.029
Further Details:      
 
Domain Number 4 Region: 2073-2163
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-20
Family Third domain of FERM 0.019
Further Details:      
 
Domain Number 5 Region: 1856-1964
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.04e-16
Family Ras-binding domain, RBD 0.077
Further Details:      
 
Domain Number 6 Region: 1347-1441
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000209
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 7 Region: 1568-1638
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000167
Family SH3-domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000007700
Domain Number - Region: 795-863
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000114
Family Motor proteins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007700   Gene: ENSCAFG00000005074   Transcript: ENSCAFT00000008307
Sequence length 2177
Comment pep:novel chromosome:CanFam3.1:21:21552554:21624277:-1 gene:ENSCAFG00000005074 transcript:ENSCAFT00000008307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSHPQGDYVWMDLRSGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATHIKPMH
PTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIR
QYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKS
RVCRQAPDERNYHVFYCMLEGMSADQKKKLGLGQATDYNYLAMGNCTVCEGREDSQEYAS
IRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLE
VNPPDLMNCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYK
PPSQEVKSSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLE
SINWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNSNYIP
PKNNHETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMG
AETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSG
MMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQDDLRGTCQRMAEAVLGTHDDWQ
IGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATVIQRHWRG
HNCRRNYELMRLGFLRLQALQRSRKLQQQYRLARRHIIEFQARCRAYLVRKAFRHRLWAV
LTVQAYARGMIARRLHRRLRAEYLRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQER
LAQLAREDAERELKEKEEARRKKELLEQMERARHEPINHSDMVDKMFGFLGTSGGLPGQE
GQAPSGFEDLERGRREMVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHTYTRR
PLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGK
KTYKRELQALQGEGEAQLPEGQKKSSMRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGN
SMLEDRPTSNLEKLHFVIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVG
CFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIML
PVTFMDGTTKTLLTDSATTAKELCNALADKISLRDRFGFSLYIALFDKVSSLGSGSDHVM
DAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEY
RCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHK
KGIYAQRRTDAQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYF
VDEQEQVLLELSFPEIMAVSSSRGAKLVAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFL
EGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILDHDTGEQVMNSGWANGINERTKQ
RGDFPTDCVYVMPTVTMPPREIVALVTMTPDQRQDVIRLLQLRTAEPEVRAKPYTLEEFS
YDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFIAML
KYMGDYPSKRMRSVNELTDQIFEGSLKAEPLKDEVYVQILKQLTDNHIRYSEERGWELLW
LCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHK
TTQIFHKVYFPDDTDEAFEVESSTRAKDFCQNIAARLLLKSSEGFSLFVKIADKVISVPE
NDFFFDFVRHLTDWIKKARPVKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQE
LPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQISPDDWK
RSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGV
SLIDPRSKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYI
SQMLTAMSKQRGSRSGK
Download sequence
Identical sequences F1PB31
ENSCAFP00000007721 ENSCAFP00000007700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]