SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008365 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008365
Domain Number 1 Region: 537-745
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-43
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 875-1027
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-33
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 5 Region: 735-857
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 41-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.48e-23
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008365   Gene: ENSCAFG00000005595   Transcript: ENSCAFT00000009016
Sequence length 1044
Comment pep:novel chromosome:CanFam3.1:22:48343160:48573544:1 gene:ENSCAFG00000005595 transcript:ENSCAFT00000009016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEQKPSPGSRLGAPENSGVSTLEHGQKLPPTPSGKLMSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEASDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIQSIRSLATPPTEPNSEVPKQAQQRASPPPGAAPEPAGAPPGAAPAAPEERPS
PAPPRSPAGGGKAAGAPRAPAEEEEEDGAAAAAEDRSPQSKAQPPQPSTGSLTGSPHLSE
LSINSQGGAVPASVILSPNLSPDTKQSSPLVSPLLNDQACPRTDDEEEGRRKRFPTDKAY
FIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTSFLKET
EQRLALWEGRSNAHIRGDYQRIGDVLLKNIQGMKQLAAHLWKHSEALEALETGIRSSRRL
ENLCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHPDFRDCRAALAEIT
EMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVIPGREFIRLGSLSKLSGKGLQQRMFFL
FNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASSR
SEMEKWVEDIQMAIDLAEKSSGPTPEFLASSPPDNKSPDEATVADQESEDDLSASRTSLE
RQAPHRGNTMVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCL
FFYKSHQDNHPLASLPLLGYSLTIPSESEDIHKDYVFKLHFKSHVYYFRAESEYTFERWM
EVIRSATSSASRTHILSHKESHVY
Download sequence
Identical sequences E2REU8
ENSCAFP00000008365 XP_005634088.1.84170 XP_013961774.1.84170 XP_013961775.1.84170 ENSCAFP00000008365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]