SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008642 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008642
Domain Number 1 Region: 166-293
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-24
Family Pleckstrin-homology domain (PH domain) 0.00000109
Further Details:      
 
Domain Number 2 Region: 849-917,986-1060,1131-1171,1295-1313,1394-1536
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000057
Family Mo25 protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008642   Gene: ENSCAFG00000005730   Transcript: ENSCAFT00000009311
Sequence length 2071
Comment pep:novel chromosome:CanFam3.1:22:48878083:49159720:-1 gene:ENSCAFG00000005730 transcript:ENSCAFT00000009311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPPLLPTAAETRKFTRALSKPGTAAELRQSVSEVVRGSVLLAKPKLIEPLDYENVIVQ
KKTQILNDCLREMLLFPYDDFQTATLRRQGRYMCSTVPADAEEEAQSLFVTECIKTYNSD
WHLVNYKFEDYSGEFRQLPNKVAKLDKLPVHVYEVDEEVDKDEDAASLGSQKGGITKHGW
LYKGNMNSAISVTMRSFKRRFFHLLQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVVQ
NNKVRRFAFELKMQDKSSYLLAADSEAEMEEWITILNKILQLNFEAAMQEKRNGDSHEDD
EQSKFEGSGSGLDSYLPELAKSTREAEIKLKSESRVKLFYLDPDAQKLDFTSAEPEVKPF
EEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIKYNRKISADFHVDL
NHFSVRQMLATTSPALMNGGRPSSPVLQDILQEAAMQYPKQGIFSVTCPHPDIFLVARIE
KVLQGSITHGAEPYMKSSDSSKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDTSGNL
DKNARFSALYRQDSNKLSNDDMLKFLADFRKPEKMAKLPVILGNLDITIDNVSSDFPNYV
NSSYIPMKQFETCSKTPITFEVEEFVPCIPKHTQPYTIYNNHLYVYPKYLKYDSQKSFAK
ARNIAICIEFKDSDEEDSQPLKCIYGRPGGPVFTRSAFAAVLHHHQNPEFYDEIKIELPT
QLHGKHHLLFTFFHVSCDSSSKGSTKKKDVVETQVGYSWLPLLKDGRVVTSEQHVPVSAN
LPSGYLGYQELGMGRHYGPEIKWVEGSKPLLKVSTHLVSTVYTQDQHLHNFFQYCQKTES
GAQALGSELVKYLKSLHAMEGHVMIAFLPTILNQLFRVLTRATQEEVAVNVTRVIIHVVA
QCHEEGLESHLRSYVKYAYKAEPYIASEYKTVHEELTKAMTTILKPSADFLTSNKLLKYS
WFFFDVLIKSMAQHLIENSKVKLLRNQRFPASYHHAVETVVNMLMPHITQKFRDNPEASK
NANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAPGDPKTLFEYKFEFLRVVCNHEHYIP
LNLPMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQECREVRLIAISVL
KNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSTVKEES
LLLPAANPLVTPQKPGIALDNSLHKDLFGAISGIASPYTTSTPNINSVRNADSRGSLIST
DSGNSLPERNTEKSNSLDKHQQSGTLGNSVVRCDKLDQSEIKSLLMCFLYILKSMSDDAL
FTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIARTGMMHARLQQLGSLDNSLTFNHSY
GHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCF
LQKHQSETALKNVFTALRSFIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTEASQ
LLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCANSDRL
IKHTTFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLD
SMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDV
GMQDVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLH
RAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLY
SDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRF
MFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMS
KKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLL
KEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQICPLEEKTS
VLPNSLHIFNAISGTPTSTMVHGMTSSSSVV
Download sequence
Identical sequences F1PNV3
ENSCAFP00000008642 ENSCAFP00000008642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]