SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008898 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008898
Domain Number 1 Region: 584-672
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-19
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 2 Region: 398-491
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 303-349,527-583
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000977
Family Second domain of FERM 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000008898
Domain Number - Region: 36-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00233
Family Ubiquitin-related 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008898   Gene: ENSCAFG00000005917   Transcript: ENSCAFT00000009583
Sequence length 695
Comment pep:novel chromosome:CanFam3.1:24:15748630:15782880:1 gene:ENSCAFG00000005917 transcript:ENSCAFT00000009583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTPILNLLPEIPAFATMLSSSDFVSASWELIVRVDDPNEEEQKDVTLRVSGDLHVGGV
MLKLVEQIKISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKILRLRLP
NVKTVRLRVSFSAVVFKAVSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKSNKEPIIE
DILNLECSPTTVGPPVSPGLYSKTMTPTYDPISGTPASSTMTWFSDSPLTEQNCSILAFS
QPPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYTFFDLNP
KYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTNESEVDE
VEAALSNLEVTLEGGKTDNTLEDITDIPKLADNLKLFRPKKLMLKAFKQYWFIFKDTSIA
YFKNKELEQGEPIEKLNLRGCEVVPDVNVAGRKFGIKLLIPVADGMNEVYLRCDHENQYA
QWMAACILASKGKTMADSSYQPEVLNILSFLRMKNRNVSSQVASNLESMDMNPECFVSPR
CAKKQKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDI
LGVSYNRLIRIDATTGIPITTWRFTNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKI
VHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGGQE
Download sequence
Identical sequences F1PW82
XP_005634859.1.84170 ENSCAFP00000008898 ENSCAFP00000008898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]