SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009469 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009469
Domain Number 1 Region: 261-437
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-24
Family DBL homology domain (DH-domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009469   Gene: ENSCAFG00000006310   Transcript: ENSCAFT00000010208
Sequence length 873
Comment pep:novel chromosome:CanFam3.1:17:30952489:30996668:1 gene:ENSCAFG00000006310 transcript:ENSCAFT00000010208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKTKTKQGENEHMPMNNPSTQIYQLQALASELKTGFTEAMQELSRIQHGEYALEEKVKS
CRCSMEEKVTEMKNSLNYFKEELSNAMSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKA
KKTQKEEHGSQAGPAQAQGSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSMHVGDS
NVKGMIGPGMNPTTPEAEENLKSCLSADIQSKSHLSSGVWRQPKDGKEWGDEYVTKDHPD
KLKDAGQGRHSSLENVLCETSLAAKRQTVALELLESERKYVINISLILKIKATFQGSDGK
RNSKERSLFPGSLRYLVQQHLDLLHALQERVLKWPRQGVLGDLFLKLTNDENNFLDYYVA
YLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIHLQNVLKFTEQEHPDY
YLLLVCVQRLRVFISHYTLLFQCNEDLLIQKRKKLKKSSMAKLYKGLASQCANTGQDTSP
TAGPEAVRDSGIHSEEILQPYPSAPSAGPAVTHLMPPVKKSQPQPSLMESMQPGKPSEWE
LEGRKHERPESLLAPAQFCAAEQDVKALAGPLQAIPEMDFEPSPAEPLANVERSLRAPAE
LLPDARGFVPAGYEEFEYGGEIFALPAPYDEEPYQAPALFENCSPASSESSLDICFLRPV
SFAMEAERPEHPLQPLPKSATSPAGSSGAYKLEAAAQAHGKAKPLSRSLKEFPRAPPAEG
VAPRLYSTRSSSGGRAPLKAERAAQPHGPAAAAAAAAAARGAPRTFFPQQRSQSEKQTYL
EVRREMHLEDTTRFCPKEERESEQTSFSDQNPRQDQKGGFRSSFRKLFKKKSSGSEYREK
TNENPSMDPSPTKQDFFRNRLALANDLDQGTAV
Download sequence
Identical sequences J9P8I9
XP_540156.3.84170 ENSCAFP00000009469 ENSCAFP00000042068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]