SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009513 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009513
Domain Number 1 Region: 350-632
Classification Level Classification E-value
Superfamily Kelch motif 9.15e-46
Family Kelch motif 0.0047
Further Details:      
 
Domain Number 2 Region: 771-917
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-23
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 3 Region: 116-238
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1051-1097
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000544
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009513
Domain Number - Region: 87-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 236-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00565
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009513   Gene: ENSCAFG00000006278   Transcript: ENSCAFT00000010258
Sequence length 1417
Comment pep:known chromosome:CanFam3.1:24:17700272:17859737:-1 gene:ENSCAFG00000006278 transcript:ENSCAFT00000010258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAAAATQARLRRRTAATTAPAGRNGGQRRDWDAAGAERPGLGAGLRLPRRRLLLLLLP
PLLLLPWAAEAAAAAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPAGWVGEQCQHC
GGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGD
SIYAPLIAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYNFDMCPN
NCSGRGECKSSNSSNTVQCECLENWKGEACDVPHCVHDCGFPDRGVCNSSDDRGCSCFPE
WQGPGCSIPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMFNHSDYNMVLAY
DLASREWLALNRSVNSVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFHIHNESWV
LLTPKAKEQYAVVGHSAHIVTLKTGRVVMLVIFGHCPLYGYISNVQEYDLAKNTWSILPT
QGALVQGGYGHSSVYDRKTRALYVHGGYKAFSANKYRLADDLYRYDVDTQMWTILKDSRF
FRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDLACDRWSVLPRPDLHHDV
NRFGHSAVLHNSTMYVFGGFNSLLLSDILVFTSEQCEAHRSEAACLAAGPGIRCVWDTVS
SHCISWELATEAQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCSDHCVPVNH
SCTEGQISISRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGW
HLVGNSCLKITTAKENYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRIMQSSQSMSKLT
LTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTRGLKAATCINP
LNGSVCERPANHSAKQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAYVASFPFGQ
CMEWYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQAP
AGNSYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETC
ISGFYGDPTNGGRCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENRYQGNPLK
GTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNLNITWAAS
FSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIKIQIAFSQ
HSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASVN
VALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAV
ASALVDISQQMPIVYKEKSGGVRNRKQQPPAQPGTCI
Download sequence
Identical sequences F1Q117
XP_534360.2.84170 ENSCAFP00000009513 ENSCAFP00000009513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]