SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009576 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009576
Domain Number 1 Region: 502-628
Classification Level Classification E-value
Superfamily TIMP-like 1.99e-27
Family Netrin-like domain (NTR/C345C module) 0.092
Further Details:      
 
Domain Number 2 Region: 332-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000128
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 262-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000963
Family Laminin-type module 0.058
Further Details:      
 
Domain Number 4 Region: 395-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009576
Domain Number - Region: 101-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0374
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009576   Gene: ENSCAFG00000006388   Transcript: ENSCAFT00000010328
Sequence length 628
Comment pep:novel chromosome:CanFam3.1:15:35525282:35649966:-1 gene:ENSCAFG00000006388 transcript:ENSCAFT00000010328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCARLLLLWGCSAVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCSYSENTDLTCRQPKCDKCNAAQPHLAHLPAAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIMVFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSTTFGLEDDVFKKGAI
CTSRYSHPFPCTGGEVIFRALSPPYDAENPYSAKVQEQLKITNLRVQLLKRQSCPCQRND
LTAKPQHFTHYAIYDFIVKGSCFCNGHADQCIPVDGFRPVKAPGAFHVVHGKCMCKHNTA
GTHCQHCAPLYNDRPWEAADGKTGSPKECRTCKCNGHADTCHFDINVWEASGNRSGGVCN
DCQHNTEGQHCQRCKPGFYRDLRRPFSAPDACKMCSCHPVGSAALPFSSVTFCDPSNGDC
PCKPGVAGPHCDRCMVGYWGFGDYGCRPCDCAGSCDPLTGDCISSGADIDWYHEIPDFHS
THNKSEPTWEWEDEQGFSALRHSGKCECKEQVLGNSKAFCGMKYSYVLKIKILSAHDKGS
HAEVNVKIKKVLKSTKLKILRGKRTLYPESWTNRGCTCPILNPGLEYLVAGHEDVRTGKL
VVNMKSFVQHWKPSLGRKVMDILKRECK
Download sequence
Identical sequences E2QZY0
XP_532655.2.84170 ENSCAFP00000009576 ENSCAFP00000009576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]