SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009762 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009762
Domain Number 1 Region: 253-405
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-32
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-23
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 57-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-20
Family First domain of FERM 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009762
Domain Number - Region: 491-555
Classification Level Classification E-value
Superfamily Prefoldin 0.0575
Family Prefoldin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009762   Gene: ENSCAFG00000006521   Transcript: ENSCAFT00000010531
Sequence length 1035
Comment pep:known chromosome:CanFam3.1:20:22401572:22576125:1 gene:ENSCAFG00000006521 transcript:ENSCAFT00000010531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLRDVYQMTEGRH
CQVHLLDDRRLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFADDTGQQNWLQLDHRV
LDHDLPKKPGATILHFAVRFYIESISFLKDKTTVELFFLNAKSCVHKGQIEADSETIFKL
AALVLQEAKGDYSSDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKIKGLTRGQ
AVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDLQDKVKPRKLFQWKQLE
NLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANPSLIKSIWVMAISQHQFYLDR
KQSKAKIPSARSLDDIAMDLTETGTPRVSKMVTLEAKSQFIMASNGSLISSGSQDSEVSE
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNVGEKPPQVRRR
VGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTD
AVKKLQEIENSINEYRIRCGKKPSQKATVILPEDIIPSESSSLSDTTTYDDSNDTFTLAG
QRPSSVPHSPRILPPKSLGIERIHFRKSSVNEQFVDTRQSREMLSTHSSPYKTLDRRPQG
GRSMPTTPVLTRNAYSSSHLEPESSAQHCRQRSGSLESQSHLLSEMDNDKPFFSLSKSQR
SSSTEILDDGSSYTSQSSTEYYCVTPVAGPYYTTQTLDTRARGRRRSKKQNVSTSNSGSM
PNLAQKDSMRNGVYTKSQEQPSSSYYIAGYTPYAECDLYYSGGYVYENDTEGQYSVNPSY
RASAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHL
RGWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRTSSYSSVSSTNASGN
WRTQIAIGLSEYETPAHSSYTSCYGNIYNPLPSPGRQYTEISQLDSTDGSRLEESLESRE
QRLFWHEDSKPGTLV
Download sequence
Identical sequences F1PXZ6
ENSCAFP00000009762 XP_541808.3.84170 ENSCAFP00000009762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]