SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010233 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010233
Domain Number 1 Region: 374-680
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-53
Family Eukaryotic proteases 0.00062
Further Details:      
 
Domain Number 2 Region: 83-199
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 3 Region: 240-310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000681
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 4 Region: 194-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000312
Family EGF-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010233   Gene: ENSCAFG00000006865   Transcript: ENSCAFT00000011041
Sequence length 680
Comment pep:novel chromosome:CanFam3.1:18:32476290:32547935:1 gene:ENSCAFG00000006865 transcript:ENSCAFT00000011041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRECCEYDQIECVCPGKKEVVGYTIPCCRNEENECDSCLIHPGCTIFENCKTCRNGSWG
GTLDDFYVKGVYCAECRAGWYGGDCMRCGQVLRASKGQILLESYPLNAHCEWTIHAKPGF
IIQLRFVMLSLEFDYMCQYDYVEVRDGDSSNGQIIKRFCGNERPAPIRSTDSSLHILFHS
DGSKNFDGFHAIFEEITACSSSPCFHDGTCLLDKTGSYKCACLAGYTGQHCENLLEESNC
SDPGGPVNGYKKITGGPGLINGRHAKIGTIVTFFCNNSYVLSGNEKRTCQQNGEWSGKQP
ICIKACREPKVSDLVRRRVLPMQVQSRETPLHQLYSAPFNKQKLQDAPTKKPALPFGDLP
PGFQHLHTQLQYECISPFYRRLGSSRRTCLRTGKWSGRAPSCVPICGKTENVTTPKSQGL
RWPWQAAIYRRASGAHGGSVHKDTWLLVCSGALVNERTVVAAAHCVTDLEKVTMIKTADL
KVVLGKFYRDDDRDEKTVQSLRISAVILHPNYDPILLDTDLAILKLLDKARVSTRVQPIC
LAAPRDLSTSFQEARITVAGWNVLADARSPGFKNDTLRSGVVRVVDSLLCEEQHEEHGIP
VSVTDNMFCASRDPAAPSDICMAQTGGIAAMAFPGRASPEPRWHLVGLVSWSYDKACSHS
LYTAFSKVLPFKDWIERNMK
Download sequence
Identical sequences E2RMW9
XP_013976505.1.84170 XP_013976506.1.84170 XP_013976507.1.84170 ENSCAFP00000010233 ENSCAFP00000010233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]