SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010563 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010563
Domain Number 1 Region: 843-951
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 326-445
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.22e-17
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 48-174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 288-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000891
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 178-325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 722-839
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000628
Family Growth factor receptor domain 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000010563
Domain Number - Region: 657-705
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00141
Family Growth factor receptor domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010563   Gene: ENSCAFG00000007092   Transcript: ENSCAFT00000011402
Sequence length 1016
Comment pep:novel chromosome:CanFam3.1:21:32371900:32434663:-1 gene:ENSCAFG00000007092 transcript:ENSCAFT00000011402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVGRGCPGTAWALLLLLGLLLLLPPPPPTAAVPRRPGRAPGPPEDVDECAQGLDDCHT
NAICQNTLTSYKCSCKPGYQGEGRQCEDIDECENELNGGCVHDCLNIPGNYRCTCFDGFM
LAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECRCKEGFFLSDNQHTCIHRLEEGLSCM
NQNHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCEDTADGPECS
CHPQYKMHADGKSCLEREDAVPEVTESNATSVVDGDKRVKRRLLMETCAVNNGGCDRTCK
DTSTGVHCSCPVGFTLQLDGKTCKDIDECQTHNGGCDHFCKNTVGSFDCSCKKGFKLLTD
EKSCQDVDECSLDRTCDHSCINHPGTFTCTCNKGYTLYGFTHCGDTNECSVNNGGCQQVC
VNTVGSYECRCHSAYKLHWNKKDCVEVKGVLPTSMSPHVSLHCGKSGGGDRCFLRCHSGI
HLSSGLQETYSVTCGSSSTLRSKQQKSNDSAFGDVTTIRTSVTFKVNEGKCSLKKAELFP
EGLRPALPEKHSSVKESFRYANLTCSFSKQVPGAPGRPSTTKEMFITVEFELEINQKEVT
ASCDLSCTIKRTEKRLRKAIRVLRKAANREHFHLQLSGMELEGANKSPRTSEHQLESCGV
GQSHAGNQCVSCRAGTYYDGVQERCMCPNGTFQNEEGQITCEPCPRSENPGALKTPEAWN
VSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGGGLPTKHLGATSFQDCET
RVQCSPGHFYNTTTHRCIRCPAGTYQPEFGKNNCVSCPGNTTTDFDGSTNITQCKDRRCG
GELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDCGDYLVMRK
TSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSARGFQVPYVTYDEDYQELIE
DIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPSIVDVD
Download sequence
Identical sequences J9NXR9
ENSCAFP00000010563 ENSCAFP00000038085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]