SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010938 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010938
Domain Number 1 Region: 83-188
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-38
Family Second domain of FERM 0.000037
Further Details:      
 
Domain Number 2 Region: 186-304
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-32
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 10-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-17
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010938   Gene: ENSCAFG00000007361   Transcript: ENSCAFT00000011799
Sequence length 665
Comment pep:novel chromosome:CanFam3.1:3:507032:686397:1 gene:ENSCAFG00000007361 transcript:ENSCAFT00000011799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLILFCKYVENRKSKSTKGSVVLDHVFRHVNLVEIDYFGLRYCDRSHQTYWLDPARTLA
EHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQL
GAYAIQAELGDYDPYKHTTGYVSEYRFVPDQKEELEEAIERIHKTLMGQTPSEAELNYLR
TAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFE
LRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPESESSSLSRRLSKFGSAGYK
HRRRTASQRSRGLCVELPRPDQNVARSRSKTYPKRAAQTQPAGPQGASPGPADAEDGGSG
GAARILAPSPVKSFKKAKNENSPDAQRSKSQVPWDENGPQSGLYNSPGDRVKSPKFPSAR
RRNPSCGSDDSVQPTRRRKAQNSGEDSDLKQRRRSRSRCNTSSGSESESSHREHRKKRHR
IRQENDMVDSAPQWEAVLRRQKEKTQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELV
DPSGLSEEQLKEIPYTKVETQGDPVRIRHSHSPRSYRQYRRSQCSDGERSVLSEMNSKTE
LVPPLPVTRSSDAQGSGGSTVHQTRNGSKDSLMEEKSQTSTSNLAGKHTAKTVKTVQASR
LRTET
Download sequence
Identical sequences F1PNX3
ENSCAFP00000010938 XP_005618092.1.84170 ENSCAFP00000010938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]