SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011650 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011650
Domain Number 1 Region: 131-311
Classification Level Classification E-value
Superfamily Sec7 domain 8.5e-46
Family Sec7 domain 0.0000848
Further Details:      
 
Domain Number 2 Region: 60-138
Classification Level Classification E-value
Superfamily F-box domain 4.71e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011650   Gene: ENSCAFG00000007874   Transcript: ENSCAFT00000012582
Sequence length 319
Comment pep:novel chromosome:CanFam3.1:25:24751197:24778228:-1 gene:ENSCAFG00000007874 transcript:ENSCAFT00000012582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLWRVPRNQQLQQKGYSEQGYLSRDQSRRMAANNISNTSHRKQVQGGIDIYHLKARK
SKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCSI
YNKNPPLGFSFRKLYMQLDEGSLTFNANPEEGVNYFMSKGILDDSPKEIAKFIFCTRTLN
WKKLRIYLDESRRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences E2QX81
9615.ENSCAFP00000011650 ENSCAFP00000011650 ENSCAFP00000011650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]