SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012707 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012707
Domain Number 1 Region: 27-221
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.81e-59
Family Astacin 0.0000921
Further Details:      
 
Domain Number 2 Region: 337-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-36
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 228-337
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-35
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 4 Region: 493-553
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-18
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 5 Region: 448-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000002
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012707   Gene: ENSCAFG00000008621   Transcript: ENSCAFT00000013739
Sequence length 567
Comment pep:novel chromosome:CanFam3.1:28:9790896:9847993:-1 gene:ENSCAFG00000008621 transcript:ENSCAFT00000013739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLHSPRTSDARAETFSSRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHW
EKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHV
VGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGEIYDFDSIMHYARNTFS
RGVFLDTILPRRDDNGIRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTAGNFSAPGF
PNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCG
DKVPEPLTSTDSRLWVEFRSSSSLLGKGFFAVYEATCGGDINKDAGQIQSPNYPDDYRPS
KECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEIRDGPTEESALIGHFCGYEKPEDV
KSSSNRMWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCVNTLGSYKCACDPGY
ELAADKKTCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFEL
EGNDVCFCTLIVLGCGSGLQTSEGLSR
Download sequence
Identical sequences F1PE27
ENSCAFP00000012707 ENSCAFP00000012707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]