SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000012751 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000012751
Domain Number 1 Region: 418-694
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-78
Family Protein kinases, catalytic subunit 0.0000000409
Further Details:      
 
Domain Number 2 Region: 864-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.57e-57
Family FAT domain of focal adhesion kinase 0.00000741
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-42
Family Second domain of FERM 0.0000203
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-33
Family First domain of FERM 0.00037
Further Details:      
 
Domain Number 5 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-30
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000012751   Gene: ENSCAFG00000008670   Transcript: ENSCAFT00000013788
Sequence length 1009
Comment pep:known chromosome:CanFam3.1:25:30137434:30264302:-1 gene:ENSCAFG00000008670 transcript:ENSCAFT00000013788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVGTLRHPQGPPESMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVHTEIQEVIASILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIKSIRCLPLEEGQAILQLGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKG
SLIIHPKKDGEKRNSLPQIPMLNLEAQRPHLSESCSIESDIYAEIPDETLRRPGGPQYGV
TREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFLSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ENINCVHRDIAVRNILVASTECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSERPRFTELVCNLSDIYQMEKDIAIEQERNARYRPPKILEPTAYQEPPPKPSRP
KYRLPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAERLKMRQILDKQQKQMVEDYQWLRQEEKSLDPMLYMNDKSP
LTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences E2QTG4
XP_005635734.1.84170 XP_005635735.1.84170 XP_013963024.1.84170 9615.ENSCAFP00000012751 ENSCAFP00000012751 ENSCAFP00000012751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]