SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013098 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013098
Domain Number 1 Region: 107-302
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.1e-59
Family Astacin 0.0000688
Further Details:      
 
Domain Number 2 Region: 734-841
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-38
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 423-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 4 Region: 574-684
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-35
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 309-418
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 6 Region: 865-958
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-27
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 7 Region: 685-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000529
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 530-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000817
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013098   Gene: ENSCAFG00000008883   Transcript: ENSCAFT00000014157
Sequence length 969
Comment pep:novel chromosome:CanFam3.1:15:61756153:61945727:1 gene:ENSCAFG00000008883 transcript:ENSCAFT00000014157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPFLGKTPNMIKAVFWGDIALDDEDLSIFQIDRTIDLTQNPFGLGHTTGGFGDHGISKK
RGALYQLIDRIRRIGSGLEQNNTVKGKAPLTFSGQNEKNRVPRAATSRTERIWPGGVIPY
VIGGNFTGSQRAMFKQAMRHWERHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQ
AISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEV
NSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLY
RCPACGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWY
DYIEVRDGYWRKSPLLGRFCGDKLPEVLASTDSRMWIEFRSSSNWVGKGFAAAYEAICGG
EIRKHEGQIQSPNYPDDYRPMKECVWKITVSEDYYVGLTFQAFEIERHDNCAYDYLEVRD
GTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRG
GCEQRCLNTLGSYQCACEPGYELGPDKRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNC
VWQVVAPTQYRISMKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQ
FNNMRIEFRSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHE
NKHDCKEAECEQKIHSPSGFITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQH
QECAYDHLEVFDGETEKSPILGRLCGNKIPEPLLATGNKMFVRFISDASVQRKGFQATHS
TECGGRLKAELKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGFRLELSFQIFEVEEEADC
GYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDAVLIHFHTDDTINKKGFHIRYKSIR
YPDTMHTKK
Download sequence
Identical sequences F1Q3H3
ENSCAFP00000013098 ENSCAFP00000013098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]