SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013497 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013497
Domain Number 1 Region: 158-248
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.98e-20
Family Ubiquitin-related 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013497   Gene: ENSCAFG00000009175   Transcript: ENSCAFT00000014591
Sequence length 256
Comment pep:novel chromosome:CanFam3.1:28:10834411:10836468:1 gene:ENSCAFG00000009175 transcript:ENSCAFT00000014591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPERPPRPEYLGATAGKGRDGGRGGAGREGVGERADHSLALEALSLSLPSCSGRNEPLKK
ERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILD
GASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPTPSVRREFPL
KVRLSTGKDVRLSASLPDTVGQLKRQLHTQEGIEPSWQRWFFSGKLLTDRTRLQETKIQK
DFVIQVIINQPPPPQD
Download sequence
Identical sequences F1PK68
ENSCAFP00000013497 XP_005637648.1.84170 ENSCAFP00000013497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]