SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013555 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013555
Domain Number 1 Region: 246-405
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000284
Further Details:      
 
Domain Number 2 Region: 33-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-31
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 3 Region: 146-243
Classification Level Classification E-value
Superfamily LCCL domain 2.35e-23
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013555   Gene: ENSCAFG00000009214   Transcript: ENSCAFT00000014656
Sequence length 730
Comment pep:novel chromosome:CanFam3.1:33:5630277:5691713:-1 gene:ENSCAFG00000009214 transcript:ENSCAFT00000014656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSYLSSRSEGILEQIMLLPRYEGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRV
KMGERVRIKFGDFDIEDSDSCHFNYLRIFNGIGVSRTEIGKYCGLGLQMNHSIESKSNEI
TVLFMSGIHVSGRGFLASYSVVDKQDLITCLDTASSFLEPEFSKYCPAGCLLPFAEISGT
IPHGYRDSSPLCMAGVHAGVVSNILGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLF
TFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPEKARLKKPGPPWAAFAT
DEYQWLQIDLNKEKKITGIVTTGSTMVEHNYYVSAYRILYSDDGQRWTVYREPGVEQDKI
FQGNKDYHQDVRNNFLPPIVARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPP
PRNSNDFKNTTAPPKIAKGRAPKFTQPLQPRSNNEFPAQTEQTTATPDIKNTTVTPSVTK
DVALAAVLVPVLVMVLTALILLAVCAWHWRSRKKKTEGTYDLPYWDRAGWWKGMKQFLPA
KSVEHEETPVRYSSSEVNHLSPREVTTMLQTDSAEYAQPLVGGIVGTLHQRSTFKPEEGK
EASYADLDPYSSPVQEVYHAYAEPLPITGPEYATPIIMDMSGHPAASVGLPSTSTFKAPG
NQPPPVVGAYNTLLSRTDSCSSARAQYDTPKGGKPGPSAPDELVYQVPQSTQEVSGAGRD
GECDVFKEIL
Download sequence
Identical sequences F1PVX2
XP_013965567.1.84170 ENSCAFP00000013555 ENSCAFP00000013555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]