SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013874 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013874
Domain Number 1 Region: 122-299
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 9.68e-50
Family CRAL/TRIO domain 0.0000368
Further Details:      
 
Domain Number 2 Region: 40-118
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 7.72e-21
Family CRAL/TRIO N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013874   Gene: ENSCAFG00000009426   Transcript: ENSCAFT00000014989
Sequence length 342
Comment pep:novel chromosome:CanFam3.1:24:31943377:31954741:1 gene:ENSCAFG00000009426 transcript:ENSCAFT00000014989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEESDSLRTSPSAASLSENELPPPPEPPGYVCSLTEELVTKAREELQEKPEWRLRDVQA
LRDMVRKECPTLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSA
LKDVLASGFLTVLPHTDPRGCHILCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQV
NGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIK
PFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGELDITAWNAVLLASEEDFVRE
FCPPVSVCDSILGQALPTEGLASDAQCDDSLRAVKSQLYSCY
Download sequence
Identical sequences E2R9P7
ENSCAFP00000013874 ENSCAFP00000013874 9615.ENSCAFP00000013874 XP_005635147.1.84170 XP_005635148.1.84170 XP_013962366.1.84170 XP_013962367.1.84170 XP_534426.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]