SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013880 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013880
Domain Number 1 Region: 2178-2477
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000072
Further Details:      
 
Domain Number 2 Region: 666-774
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-33
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 3 Region: 1353-1457
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-28
Family PDZ domain 0.0000199
Further Details:      
 
Domain Number 4 Region: 1074-1185
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-27
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 5 Region: 776-882
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-26
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 6 Region: 1787-1876
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-22
Family PDZ domain 0.012
Further Details:      
 
Domain Number 7 Region: 1487-1599
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.034
Further Details:      
 
Domain Number 8 Region: 1879-1971
Classification Level Classification E-value
Superfamily PDZ domain-like 2.8e-18
Family PDZ domain 0.047
Further Details:      
 
Domain Number 9 Region: 572-665
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-16
Family First domain of FERM 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000013880
Domain Number - Region: 2-154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000381
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013880   Gene: ENSCAFG00000009427   Transcript: ENSCAFT00000014995
Sequence length 2490
Comment pep:novel chromosome:CanFam3.1:32:10125380:10328285:1 gene:ENSCAFG00000009427 transcript:ENSCAFT00000014995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSIADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNL
SGTDQLSHNSEQKPDRSQAIRDRLRGKGLPTGRSATSDVLDIHKSPFSHQTFLNKGLSKS
MGFLSIRDTQDEEDYFKDISSDNNSGHEDSENASSPYQFKTSGPEKRTIPGIDVLPKKKI
WASSMDLLCTADRDFSGETGGFRQYLPETVTVRTSTTPRKKEARYSDGSIALDIFGPQKV
DPMFHARELPTSSAISSALDRIRERQKKLQVLREAMNVEEPIRRYKTYHSDIFSTSSESP
SIISSESDFRQVQKSEASKRFESNSGLPGVDESTSQDQSQRPSRQYETPLEGNVINQEIM
LKRQEEEMIQLQARMALRQSRLSLYPGDTIKASMLDISRDPLREMALETAMTQRKLRNFF
GPEFVKMTIEPFISLDLPRSILAKKGKNEDNRRKVNIMLLSGQRLELTCDTKTICKDVFD
MVVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKSKATINFTLFFR
IKFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVH
GVSYFRLEHYLPPRVMEKLDLSYVKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVH
FHRVHPEKKSQTGILLGVYSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTS
DGIKHAFQTDNSKVCQYLLHLCSSQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVR
GFNMGRAISTGSLASSTLNKLAVRPLSVHAEILKRLSCSELSLYQPLQNNAKEKSDKTSW
EEKPRGMSKSYHDLSQASLYPHRKNAIVNMESPPQTMAKLVGKPLHQMARSETESWAGFT
KLNNSKSVASLNRSPERKKHESDSSSFEDPGQAYVIGMTLHSSGNPSSQVPLKENDVLHK
RWSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGVFISSITPGGPADLDGCLK
PGDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKIPKVPSTPVHVASGMKNY
MKKPSYMQGNAIDSSSEDHRWPHGIPRHISESSFGLSGGLREGSLSSQDSRTESASLSQS
QVNGFFASPVGDRTWQESQHGSPSPSVISKTIEKKRNSTDSNRSKTKKTGISDATDYSDR
GDSDMDEATYSSSQDHQTSKKESSSSVNTSNKMNFKTFPSSPPKPGDIFEVELAKNDNSL
GISVTGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETL
RNTGQVVHLLLEKGQSPGTSKEHVPMTSQSILPDPDSQGQDPDKMKKMIHVKDYSFVTEE
NTFEVKLFKNSSGLGFSFSREDSLIPEQMNASIVRVKKLFPGQPAAESGKIDVGDVILKV
NGASLKGLSQQEVISALRGTSPEVSLLLCRPSPGVLPEIDPALLTPLHSPAQVIPNNSKD
SSQPTCVEQGTSSDENEMYDKSKKQCTSPSRRNSYSDSSGSGEEDLVKALTKIPNMSWSS
SLHQTLSNVVSQAQSQHEAPKSQEDTICTMFYYPQEIPSKPELEDSNPPSPLPPNTTLGQ
SYQPQSESVSTNSMDRYHIRHIFEPTRQESLTSLKNDLENHLEDFELEVELLITLIKSEK
GSLGFTVTKGNQSIGCYVHDVIQDPAKSDGRLRPGDRLIKVNDTDVTNMTHTDAVNLLRA
APKTVRLLLGRVLELPRMPVLPHLLPDIILTCNKEELGFSLSGGHDSLHQVVYISDINPR
SVAALEGNLQLLDIIHYVNGVSTQGMTLEEAKRALDMSLPSVVLKATRDGHPVVPSSKRS
AVSTPKSTKANGHHTLEPCHKPALTPSNSFSKVNGEEIIEVLYPKGKCSTYQMKGSANLI
LSKESNVQEDDIYDDPQEAEVIQSLLDVVDEEAQNLLNQNNAAEDACVPDSLKTNRKLSE
ERAEDTDYDGSPLPEDFTESVKMNGCEEYCEEKVKIESLIQKSQERKPEDDDEITWGSDE
LPIETTNHEDSSEDHPFLTDEQLAALPIVKVLPSGKYTGSKLKSVIRTLRGLLDQGIPSK
ELENLQDLKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKE
EFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGQTTMVND
RLRLALVRMQQLKGFVVRAMALEEIQTGEMRHISHLNFTAWPDHDTPSQPDDLLTFISYM
RHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLEFDISDLVRCMRLQRHGMVQTED
QYIFCYQVILYVLTRLQTEEEQKEQPQLLK
Download sequence
Identical sequences F1PMK1
XP_013965442.1.84170 ENSCAFP00000013880 ENSCAFP00000013880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]