SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015673 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015673
Domain Number 1 Region: 90-129
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000968
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015673   Gene: ENSCAFG00000010659   Transcript: ENSCAFT00000016941
Sequence length 135
Comment pep:novel chromosome:CanFam3.1:25:42206914:42287818:1 gene:ENSCAFG00000010659 transcript:ENSCAFT00000016941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWLPETLFEIVGQGPAPSKDYYQLLVTRSQVIFRWWKISLRSEYRSAKPGETKDSHGA
FLENSHLQVQIALIFGARILDYVFNLCEGKFDFLERLSDNLLLSIISYLDLEDIARLSQT
SRRFAKVTDNYFVFT
Download sequence
Identical sequences E2R576
ENSCAFP00000015673 ENSCAFP00000015673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]