SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017002 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017002
Domain Number 1 Region: 272-430
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.54e-58
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000245
Further Details:      
 
Domain Number 2 Region: 112-270
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000096
Further Details:      
 
Domain Number 3 Region: 67-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000255
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 25-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000544
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017002   Gene: ENSCAFG00000011555   Transcript: ENSCAFT00000018357
Sequence length 430
Comment pep:novel chromosome:CanFam3.1:3:52054885:52064689:-1 gene:ENSCAFG00000011555 transcript:ENSCAFT00000018357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTCPFLETSNCGANHTSIGAGDIAGDFCDSSQCLNGGTCLLGQDNTPFYCLCPQGFTGLI
CNETEKGPCIPNPCHNDAECQVIDDLHRGDVFTQYVCQCPHGYTGTHCEITCAMPLGMET
GSIADSQISASSVHLGFMGLQRWAPELARLHRTGIVNAWTASNYDKNPWIQVNLMRKMRV
TGVVTQGASRAGSAEYLKTFKVAYSVNGRKFQFIQDAEGTGDKIFVGNMDNNGLKVNLFD
FPLEVQYVRLVPIICHRGCTLRFELLGCELNGCAEPLGMKDNTIPDKQITASSIYRTWGL
NAFSWYPFYARLDKQGKFNAWTAQTNDASEWLQVDLGFQRQVTGIITQGARDFGHIQYVA
AYKVAYSNDSKNWTEYKDQGAIEGKIFPGNLDNNSHKKNMFEMPFLARFVRILPVAWHNR
ITMRVELLGC
Download sequence
Identical sequences F1PFZ5
ENSCAFP00000017002 ENSCAFP00000017002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]