SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017097 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017097
Domain Number 1 Region: 288-415
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 417-521
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-24
Family Third domain of FERM 0.0052
Further Details:      
 
Domain Number 3 Region: 62-154
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 199-282
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000455
Family Ras-binding domain, RBD 0.077
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000017097
Domain Number - Region: 32-63
Classification Level Classification E-value
Superfamily WW domain 0.000164
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017097   Gene: ENSCAFG00000011627   Transcript: ENSCAFT00000018460
Sequence length 1318
Comment pep:known chromosome:CanFam3.1:X:9031850:9229271:1 gene:ENSCAFG00000011627 transcript:ENSCAFT00000018460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFFFFFFSSHRTKSSGWPPPSGTWGLNQVPPYGWEMTANRDGRDCFINHMTQGIPFDDP
RLESCQILPPAPRRVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVMIN
DEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSEEV
IINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEH
FSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPVA
FEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLET
FLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVF
KATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEEDSLVRVEL
HVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTGTQETGAENKGKH
NLLGPDWNCIPQMTTFIGEGEQEAQITYIDSKQKTVDISDGTLCPKDHRHLYLDNTYNPD
ELNQPLTQPGDAACEADYRSLAQRSLLTLSGPETLKKAQESPRGAKVSFIFGDLALDDGL
NPPTLGYERLLEESPELLEKQRNLYISSANDMKGLDLTPDAESIQFVANSVYANIGDVKN
FEAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILNLSGSSDDIIDLT
SLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFLEDKEPGRSLQNDE
IPVSLIDAVPTSAEGKCEKGLDSTVVSTLEALEALSVSEEQQTSDNSGVAILRAYSPESS
SDSGNETNSSEMTENSELATAQKQSESLSRMFLATHEGYHPLAEEQTEFPASKAPAGGLP
PKPPHGLAARPGTDLPPPVVPSKQILHPDPMEMEPETMETKSVTDYFSKLHMGSVVYSCT
SKRKSKLADGEGKAPPSGNVPGKKQQGTKSAEAEEEAKGKFGTVSSRDSQHLSTFNLERT
AFRKDSQRWYVATEGAVADKSGLEAATGIPFPRAPGLGPREAEEKDEGAPDGEAGEVSAL
GQRDHFLTDVTCVSSAKDLDNPEDTDPSTCDHPSKLPEAEESVARLCDYHLAKRMSSLQS
ECHFSLQSSQGSSVDAGCGTGSSSSTCATPVESPLCPAMGKHLIPETSGKGMSYIPAEER
ATGLPSHGATFKELHPQTEGMCPRMAVPALHTAINAEPLFGTLRDGCHRLPKIKETTV
Download sequence
Identical sequences F1PDD7
ENSCAFP00000017097 ENSCAFP00000017097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]