SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017303 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017303
Domain Number 1 Region: 297-607
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 9.94e-41
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 709-878
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-26
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 91-213
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1015-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000264
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000017303
Domain Number - Region: 61-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0265
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017303   Gene: ENSCAFG00000011725   Transcript: ENSCAFT00000018678
Sequence length 1381
Comment pep:known chromosome:CanFam3.1:28:25816300:26605650:1 gene:ENSCAFG00000011725 transcript:ENSCAFT00000018678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPGGRARMGPPQPAAPGLCKARPVRGGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQ
SKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKC
TWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPE
VVTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSISVPSQVYCECDKYW
KGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPF
SPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGSLSRGPLQRYGHS
LALYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIM
ELDSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITK
SIYVHGGYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGN
THNDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGF
SSVLLNDILVYKPPNCKAFRDEELCKNAGPGIKCIWNKNHCESWESGNTNNILRAKCPPK
TAAPDDRCYRYADCASCAANTNGCQWCDDKKCISANSNCSVSVKNYTKCHVRNEQICNKL
TSCKSCSLNLNCQWDQRQQECQALPAHLCGEGWNHIGDACLRINSSRESYDNAKLYCYNL
SGNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPG
EPNDSGFCAYLEKAAVAGLKANPCTSMADGLVCEKPVVSPNQNARPCKKPCSLRTSCSNC
TSNGMECMWCSSTRRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGHCLEQPGCG
WCNDPSNTGRGHCIEGSSRGPMKLVGMHNNEMVLDTSLCPKEKNYEWSFIQCPACQCNGH
STCINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHMHTGKCFCT
TKGIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQ
SNKNLDISINASNNFNLNITWSVGSTAGTISGEETPIVSKTNIKEYRDSFSYEKFNFRSN
PNITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCW
ASRRREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAV
LTVFLCLPRGSSGAPPPGQSGLAIASALIDISQQKPSDSKDKTSGVRNRKHHLSTRQGTC
V
Download sequence
Identical sequences E2R6C0
ENSCAFP00000017303 XP_544031.3.84170 9615.ENSCAFP00000017303 ENSCAFP00000017303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]