SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018488 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018488
Domain Number 1 Region: 882-1183
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000105
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-32
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-29
Family Second domain of FERM 0.00041
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018488   Gene: ENSCAFG00000012530   Transcript: ENSCAFT00000019934
Sequence length 1187
Comment pep:novel chromosome:CanFam3.1:7:12343277:12452350:-1 gene:ENSCAFG00000012530 transcript:ENSCAFT00000019934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLETVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFSNEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFSVKDNHGNSVHLGIFFMGIF
VRNRIGRQAVIYRWNDIGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSIFH
GNEEALYYNSHNSLDLNYLNGTVTNGSVCSVHSVNSLSCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVLHADSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGGYGHKLVSPSDQINPKNNSVPSKPGASAISHTVSTP
ELANMQLQGTQNYNTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGAVNKRHSLEVMSSMVRGMEAMTLKS
LNIPMARRNTLREQGPPEEVPGSHEAHQLPHYHHKKTFSDATMLIHSSESEEEEEEVPGS
VPQIPVLREKMGYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQVSLPPAMARARV
LRHGPAKAISVSRADQLAVAGPSLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
VEREMALRNLEKQKMASLEAQKRPLMLAALNGLSVARVSGREENRADATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGANVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLEGPRNLHPPIVVHCSAGVGRTGVVILSELMIYC
LEHNEKVEVPMMLRLLREQRMFMIQTITQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences F1PU81
XP_013970574.1.84170 ENSCAFP00000018488 ENSCAFP00000018488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]