SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018721 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018721
Domain Number 1 Region: 77-272
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.19e-59
Family CRAL/TRIO domain 0.00000000405
Further Details:      
 
Domain Number 2 Region: 276-396
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 6.15e-35
Family Supernatant protein factor (SPF), C-terminal domain 0.000000433
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.07e-21
Family CRAL/TRIO N-terminal domain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018721   Gene: ENSCAFG00000012703   Transcript: ENSCAFT00000020183
Sequence length 408
Comment pep:known chromosome:CanFam3.1:26:23542659:23562724:1 gene:ENSCAFG00000012703 transcript:ENSCAFT00000020183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPRQKEALAKFRENVQDVLPTLPNPDDYFLLRWLRARNFDLQKSEAMLRKHV
EFRKQKDIDHITSWQPPEVVQQYLSGGMCGYDLDGCPIWYDIIGPLDAKGLLLSATKQDL
LKTKMRDCERLLQECARQTEKMGKKVETVTLIYDCEGLGLKHLWKPAVEAYGEFLCMFEE
NYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKYVSPDQLPVE
YGGTMTDPDGNPKCKSKINYGGDIPKKYYVRDQVKQQYEHSVQISRGSSPQGEYEILFPG
CVLRWQFMSDGSDIGFGIFLKTKVGERQRAGEMTEVLSNQRYNAHLVPEDGTLTCSDPGI
YVLRFDNTYSFIHAKKVSFTVEVLLPDKASEEKMKQLGAVTPKSQEMA
Download sequence
Identical sequences E2RN29
ENSCAFP00000018721 ENSCAFP00000018721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]