SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019551 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019551
Domain Number 1 Region: 275-430
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000667
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.85e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000175
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-34
Family Spermadhesin, CUB domain 0.000019
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-28
Family MAM domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019551   Gene: ENSCAFG00000013191   Transcript: ENSCAFT00000021053
Sequence length 926
Comment pep:novel chromosome:CanFam3.1:37:14293934:14409766:1 gene:ENSCAFG00000013191 transcript:ENSCAFT00000021053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMFPLTWVVLALYFSGCEVRGQPDSPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQDPPENFQCNVPLGMESGRIANEQISASSTYS
DERWTPQQSRLHGDDNGWTPNLDSSKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHTPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIPDSQISASSTREYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGVPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGRDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPIDEEATECGENCSFEDDKDLQLPSGFNCNFDLPEEPCGWMYD
HAKWLRSTWTSSSSPNDRTFPDDRNFLRLQSDGRREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGLALQVVREASQESKLLWVIREDQGNEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAVDIPEIHGREGYEDEIDDEYEVDWTNSSSPTS
GSGAPSADKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTL
ENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences E2RJ14
ENSCAFP00000019551 ENSCAFP00000019551 XP_859506.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]