SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020424 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020424
Domain Number 1 Region: 401-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.08e-77
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-33
Family Spermadhesin, CUB domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-31
Family Spermadhesin, CUB domain 0.0000241
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020424   Gene: ENSCAFG00000013838   Transcript: ENSCAFT00000021994
Sequence length 763
Comment pep:novel chromosome:CanFam3.1:34:19699308:19750448:-1 gene:ENSCAFG00000013838 transcript:ENSCAFT00000021994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLYHVLCLSLLKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPEGFRIKL
YFMHFNLESSYLCEYDYVKVETEEQVLATFCGRETTDTEQTPGQEVVFSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYLLHTDNRT
CRVECSDNVYTQRTGVITSPDFPNPYPKSSECFYTIELEEGFMVSLQFEDIFDIEDHPEV
PCPYDYIKIKAGPKVLGPFCGEKAPEPINTESHSVQILFRSDNSGENQGWRLSYRATGNE
CPDPELPVHGKIEPLQATYSFKDQVLISCDTGYKVLKDNVEMDTFQIECLKDGTWSNRIP
TCKIADCGAPAELKHGLITFSTRNNLTTYKSEIQYSCQQPYYKMLHNITGVYTCSAQGVW
MNEVLGRSQPTCLPVCGQPSRSLPNLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKW
FGSGALLSESWILTAAHVLRSQRRDNTVTPVSKEHVTVYLGLHDVRDKSGAVNSSAAQVV
LHPDFNIQNYNHDIALVQLREPVPLGPHVMPICLPSPEPEGPEPHMLGLVAGWGISNPNV
TVDEIISSGTRTLSDVLQYVKLPVVPYAECKTSYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFVILDDLSQRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWLWEQMGSPQG
LGDLQVERVWGPQVLSEADGQDLQWTPSPERNHPLDCHAVIPK
Download sequence
Identical sequences F1PQ85
ENSCAFP00000020424 ENSCAFP00000020424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]