SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021199 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021199
Domain Number 1 Region: 431-687
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-72
Family Eukaryotic proteases 0.0000000553
Further Details:      
 
Domain Number 2 Region: 25-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-31
Family Spermadhesin, CUB domain 0.000000791
Further Details:      
 
Domain Number 3 Region: 180-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-25
Family Spermadhesin, CUB domain 0.000074
Further Details:      
 
Domain Number 4 Region: 365-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.0000336
Further Details:      
 
Domain Number 5 Region: 307-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 133-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family EGF-type module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021199   Gene: ENSCAFG00000014346   Transcript: ENSCAFT00000022823
Sequence length 695
Comment pep:known chromosome:CanFam3.1:27:37976132:37985995:-1 gene:ENSCAFG00000014346 transcript:ENSCAFT00000022823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLPEMWCIVLFSLLASVYAEPTMYGEILSPNYPQAYPNEIEKSWNIEVPEGYGIHLYF
THLDIELSENCAYDSVQIMSGDFEEGKLCGQKTSKNPNSPIVEEFQIPHNRLQVIFKSDF
SNEERFTGFAAYYVAVDINECTDFADVPCSHFCNNFIGGYFCSCPPEYFLHEDMKNCGVN
CSGDVFTTLTGEITSPNYPNPYPENSRCDYQIQLEDGYQVVVTVRREDFDVESADSNGHC
PDSLVFVAGDKQFGPYCGKGFPGPLNIETKSSALNIIFQTDQTGQKKGWKLRYRGDPIPC
SKEVTANSVWEPEKAIYVFKDVVKITCLEGFEVVQGSVGSSSFYSTCQSNGKWSNSKLKC
QPVDCGSPEPIQNGKAEDPEHTLFGSVIHYTCEEPYYYLEDEESGEYHCAGNGSWVNKLL
GTELPKCVPVCGVPSKPFMGKQRIFGGSLAEIQNFPWQVFFSNPRAGGALIDEYWVLTAA
HVVERNREPVMYVGSTSVVTSELTKAQMLTAERVIIHPDWEFLDDPETRKNFNNDIALVQ
LKEPVKMGPNVSPICLPGTSSEYDPPMGALGLISGWGRTKARDHVIMLRGASLPIVPLEK
CREVKGKNVKVDINTYVFTNNMICAGGEKGVDSCEGDSGGAFALRVPNEETLKFYVAGLV
SWGPQCGTYGIYTRVKNYIDWIRQTMQEHSTPSMD
Download sequence
Identical sequences F1P6E1
ENSCAFP00000021199 XP_005637267.1.84170 XP_853320.1.84170 ENSCAFP00000021199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]