SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021345 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021345
Domain Number 1 Region: 243-523
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.49e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000147
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-28
Family SH2 domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 93-213
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-25
Family SH2 domain 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021345   Gene: ENSCAFG00000014463   Transcript: ENSCAFT00000022979
Sequence length 595
Comment pep:known chromosome:CanFam3.1:27:38084524:38096803:-1 gene:ENSCAFG00000014463 transcript:ENSCAFT00000022979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGLGSPLRVTHIKVMCEGGRYTVGG
AETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHTRVILQGRDSNIPGSD
YINANYVKNELLGPDENTKTYIASQGCLEATVNDFWQMAWQENTRVIVMTTREVEKGRNK
CVPYWPEVGTQRAYGPYVVTNCREHDAAEYKLRTLQVSPLENEDLVREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVMQSQKGRESEYGNIT
YPLAMKNAHAKASRTSSKHKEDVYENLQSKNKKEEKVKKQRSADKEKSKGSLKRK
Download sequence
Identical sequences E2RFR8
ENSCAFP00000021345 XP_005637268.1.84170 ENSCAFP00000021345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]